KEGG   Sarcophilus harrisii (Tasmanian devil): 100926340Help
Entry
100926340         CDS       T02286                                 

Gene name
TGM5
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 5
  KO
K05622  transglutaminase 5 [EC:2.3.2.13]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100926340 (TGM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100926340
NCBI-ProteinID: XP_023356476
Ensembl: ENSSHAG00000011949
LinkDB All DBs
Position
1
AA seq 711 aa AA seqDB search
FTGLEVSVSDFQYFQNNVQHHTEEISFQRLIVRRGQPFSITLYFKSRGFQSDMDKIIFIT
ETGPKPDLSMGTRAIFSIEEPSFKSPWIAVVKSNGANFLEVSLCAPPMAAIGQYYLKVHI
DSFQGPVSAYHLGEFILLFNPWCPADEVYMESEPQRQEYIMNDHGFIYQGNKNWIRPCPW
NYGQFEEDIIDICLKLLDKSLNFQVDPAMDCALRGSSVYISRVVSAMINSNDDNGVLNGK
WSEGYSDGISPSEWNGSVAILKQWYATAGQPVKYGQCWVFAAVMCTVMRCLGIPTRVITN
FDSGHDTDGNLIIDAYYDHTGRILENKKKDSVWNFHVWNECWMARKDLPPEYGGWQLLDA
TPQETSNGVYCCGPASVKAIKEGEVELNYDTAFAFSMVNADCVSWLVYGGKEQRLHRDTN
LVGNLISTKSIQSDERDDVTENYKYQEGSPLERKVFLKALQKVQYRGLPGNPEGHFQPLP
ETEVGNPDLISSTGSKEVSLKFKLVEPAYMGLDINLVLQTINLVLKFKELKVNLSAQSIL
HEGNPLPVFWQDTAFITLMPGEAKTYPCIIPYSKYSQFLSPDKIIRISALGEEKNSLKKL
LVDKIITLELPSILITVLGEAIVGQTLTIQVIFENPLLEEVGDCELTVEGSGLFKKQQKI
ILGNLKPQSKASITIKTVPFKSGQRQIQANLKSDKFKDIKGYSNVNVAPAS
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
ttcacagggctggaggtttctgtctctgatttccagtactttcagaacaatgtgcagcac
cacacagaggagatcagcttccaacggctcattgtgcgtcggggccagcccttctccatc
accctgtactttaagagcaggggattccagtccgacatggacaaaatcatcttcatcaca
gagactggtccaaagcctgacctctccatgggcacccgagccatattctccatagaagag
ccaagcttcaagagcccttggatcgcagtggtcaaatctaatggggccaacttcttggaa
gtcagcctgtgtgctccacccatggcagcgattgggcaatactatctgaaagttcacatc
gattccttccaaggaccagtctcagcttatcaccttggagagttcatccttctcttcaat
ccttggtgtccagctgatgaagtctatatggaaagtgagcctcagagacaggaatacatc
atgaatgatcatggcttcatctaccagggtaacaagaactggatccgtccgtgtccatgg
aactatggacagtttgaggaagatatcatagatatttgcctgaagctattagacaagagt
ttgaattttcaagttgatccagccatggactgtgcactgcgggggagctccgtatacatc
agcagagtcgtcagtgccatgatcaacagcaatgatgacaatggtgttctcaatgggaaa
tggagtgagggctactctgatggaattagcccttctgaatggaatggtagtgtagccatc
ttgaagcaatggtatgccacagcaggccagcctgtgaaatatggacagtgctgggtcttt
gcagctgttatgtgtacagtgatgagatgtctggggatccccactcgtgttattaccaat
tttgattccgggcatgacacagatggaaatttgataattgatgcgtattatgaccacact
ggcaggatcctggagaataagaagaaggacagtgtatggaattttcatgtgtggaatgaa
tgttggatggcacggaaagatcttcccccagaatatggaggctggcagttgctggatgct
actcctcaagagacaagcaatggtgtctactgctgtggtcctgcctcagtcaaagccatc
aaggaaggggaggtggagctgaactacgacaccgcttttgccttctccatggtgaacgct
gactgcgtgtcctggctcgtttatggggggaaggagcagagacttcaccgagataccaat
ctggtgggcaaccttatcagtaccaagagcatccagagcgacgagagggacgacgtaact
gagaactacaagtaccaagaaggttcacccctggagcgaaaggtgtttctgaaggctctt
cagaaagttcagtatagaggacttccagggaatcctgaaggacatttccagcctctacca
gaaacagaagtgggaaacccagacttgatttcttccactgggtcaaaggaagtgagcctg
aaattcaagctggttgagcctgcctacatgggcctagacataaatcttgttctacagacc
atcaacttggttctaaaattcaaggagcttaaggtgaacctgagtgcccagtccatcctc
catgaaggcaatcccctgcctgtgttctggcaagacacagcattcatcactctaatgcct
ggtgaagcaaagacgtatccctgcataatcccctattccaagtacagccagtttctgtca
ccagacaaaattatccggatcagcgccctgggagaagagaagaacagtttaaagaagctc
ttggttgacaagatcatcaccttggaactcccgagcatcttgattactgttctgggagaa
gccattgtgggccagacacttaccatacaagtgatatttgaaaatcctctcttggaggag
gtaggggattgcgagctgactgtggaaggcagtggcctgttcaagaaacagcagaagatc
attcttggaaacctcaagccccaaagtaaagccagcatcactattaaaactgttcctttc
aagagcggccagcggcagatccaagccaatctgaagagcgacaagtttaaggatatcaaa
ggatacagcaacgtgaatgttgcccctgcatcataa

DBGET integrated database retrieval system