KEGG   Sarcophilus harrisii (Tasmanian devil): 100926427
Entry
100926427         CDS       T02286                                 

Gene name
CCDC6
Definition
(RefSeq) LOW QUALITY PROTEIN: coiled-coil domain-containing protein 6
  KO
K09288  coiled-coil domain-containing protein 6
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05200  Pathways in cancer
shr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100926427 (CCDC6)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100926427 (CCDC6)
SSDB
Motif
Pfam: DUF2046
Other DBs
NCBI-GeneID: 100926427
NCBI-ProteinID: XP_031805244
LinkDB
Position
2
AA seq 640 aa
MRTRDTQRVAHTARPRTLYRTGSGHGSAPDFRAGSGFWWMPSGRAASRPLSLQQGDQRLG
HSERLVNAPRWLCFVPSAVHTDFAHVDYSAIHRSRGAAAARARPRRSRAPRAPLRSFSSA
AAAAAAPRACAGPGPAPRSRGASRSSPLPGPRRACAGHGADSASESDTDGGRPGGGGPAG
XGGGGGVAVVLPGAGGGGGGAGGGPGPGGGGKPGGIVISPFRLEELTNRLASLQQENKVL
KIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVN
YEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLE
QLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVSAPPSPRDISMEID
SPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREENLRLQRKLQREME
RREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSPSSSRPISPGLSYT
SHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGASHGITRPSPRRSNSPDKFKRPTPPPSPN
TQTPVQPPPPPPPPPMQASLPSATSPPASSPHPVHPPPQP
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgcgcacccgggacacacagcgtgtggcgcacactgcacgcccacgcaccctgtaccgg
acgggatcagggcatgggtcggcccctgatttccgggccggatcgggcttctggtggatg
cccagtggtcgggctgcctcgcggcctttgtccctgcaacaaggggaccagcggctggga
cacagtgagcgcttagtaaatgctccccgctggctttgctttgtacctagtgcagtccat
acagactttgcccacgtcgattacagtgcaattcacaggagccgaggtgcagcggccgcc
cgggctcggccccgccggtcccgggccccgcgcgctccgctccgctctttctcctcggcc
gccgccgccgccgccgcgccgcgagcgtgcgccggccccggccctgcgccccgctcccgc
ggcgcctctcgtagctcgccgctccctggtccccgccgcgcctgcgcgggccatggcgcc
gacagcgccagcgagagcgacacggacggcgggcggcccgggggcggcgggccggcgggc
nncgggggcggcggcggcgtggcagtcgtgctcccgggcgcgggcggcggcggcggcggc
gcgggcggcgggcccgggcccggcggcggcgggaagccgggcggcattgtcatctcgccg
ttccgcctggaggagctcaccaaccggctggcgtcgctgcagcaggagaacaaggtgctc
aagatcgagctggagacgtacaagctcaagtgcaaggcgctgcaggaggagaaccgggac
ctgcgcaaggccagcgtcaccatccaagccagggctgagcaagaggaggagttcatcagc
aacaccttgttcaagaagattcaggccttgcagaaggagaaggagactctcgccgtgaat
tacgagaaggaagaggagttcctcaccaatgagctgtccaggaaactgatgcagctgcag
cacgagaaggcagagctggagcagcacctggagcaggagcaggagttccaggtcaataaa
ctgatgaagaaaatcaagaagctggagaacgacaccatctcgaagcagctcacgctggag
cagctgcggcgggagaagattgacctcgaaaatacattggagcaagagcaggaggcgctg
gtcaatcgtctctggaagaggatggacaagctggaggctgagaaacgaatcttgcaggag
aaattggaccagcccgtctcggctcccccgtcgccccgggacatctccatggagatcgac
tctccagaaaacatgatgcggcacatccggtttttaaagaatgaagtggagagactgaag
aagcagctgcgagctgcccagctacagcactcggagaagatggcccagtatttggaggag
gagcgccacatgcgggaagagaacctgcgcctgcagaggaagctccagcgcgagatggag
cggagggaggccctctgccggcagctctcagagagcgagtccagcttggagatggacgac
gaaaggtattttaacgagatgtctgcccaaggcttacgacctcgcactgtgtccagcccg
atcccttacacgccttctcccagttccagcaggcccatctcaccgggtctgtcgtacaca
agtcacacagttggcttcacgcccccgacgtcgctgacccgagccggaatgtcttactac
aactcccccggactccatgtgcagcacatgggagcctcccacgggatcacaaggccttca
ccccggagaagcaacagtccggacaaatttaagcgccccacgcctccgccatctccgaac
acacagactcccgtccagcctcctccgcctccgcccccaccccccatgcaggcctccctc
ccgtccgccacctcgccgcccgcctcctcaccacatccggtgcatccccccccacagccc
tag

DBGET integrated database retrieval system