KEGG   Sarcophilus harrisii (Tasmanian devil): 100926491
Entry
100926491         CDS       T02286                                 

Gene name
TPR
Definition
(RefSeq) nucleoprotein TPR isoform X1
  KO
K09291  nucleoprotein TPR
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03013  RNA transport
shr05014  Amyotrophic lateral sclerosis
shr05200  Pathways in cancer
shr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    100926491 (TPR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100926491 (TPR)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100926491 (TPR)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100926491 (TPR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:shr03019]
    100926491 (TPR)
Messenger RNA biogenesis [BR:shr03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100926491 (TPR)
SSDB
Motif
Pfam: TPR_MLP1_2 AAA_13 TFIIA Ntox1
Other DBs
NCBI-GeneID: 100926491
NCBI-ProteinID: XP_023357598
Ensembl: ENSSHAG00000015305
LinkDB
Position
4
AA seq 2362 aa
MAAVLQQVLERQELTKLPKPVQAKLEKFLADQQSEIDCLKGRHEKFKVESEQQYFEVEKR
LSQSQERLVNESRECQILRQELEKLNQQLKSVTEKNKELETAQDRHVAIQSQLTRAKEEL
EAEKRDLVRTSERRSQELEYLTEDVKRLNEKLKESNTSKGELQLKLDELQASDVSVKYRE
KRLEQEKELLHNQNTWLNTELKTKTDELLAVGREKGNEILELKCNLENKKEEVSRMEEQL
NGLKTSNDHLQKHVEDLLTKLKEAKEQQANMEEKFHNELNAHMKLSNLYKSAADDSEAKS
NELTGAVDELHKLLKEAGETNKGMQDHLMEVEESKAQMEKEMLEKICKLERELENANDLL
SATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRIN
KYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKHSS
VLERDNQRMEIQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSADISSSSEVISQHLVSY
RNIEELQQQNQRLLVALRELGETREREEQETTSSRITELQIQLESALTELEQLRESRHHQ
MQLVDSIVRQRDMYRILLSQTTGVVIPLQASSLEEISLVSTPKHSSGVSQTISTPAPVST
VESTEAIEAKAALKQLQEIFENYKKEKVENDKIQNEQVEKLQEQVTDLRSQNTKISTQLD
FASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEV
RAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGILERSETETKQRLNN
QIEKLEREISQLKKKLENEVEQRHTLTRNQDVHLLDTKRQLETEINRHLNTKELLKNAQK
EAATLKQQLNNVEAQLASQSAQRAPGKGQPNTKEDIDDLISQLRQAEEQINDLKERLKTT
SSNVEQYRAMVLSLEESLNKEKQVTEEVRKNIEARLKDSAEYQAQLEKKLMEAEKEKQEL
QDEKRRALESMEQQLSELKKTLSNVQNEVQEALQRASTALSNEQQARRDCQEQAKIAIEA
QNKYERELMLHAADVEALQAAKEQVSKNLLVRQQLEETAQKAESQLLECKASWEERERML
KDEAAKCVSRCEDLEKQNTLLHDQIEKLSDKVVTSMKEGVQGSLNVSLNEEGKSQEQILE
ILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQ
HEELMKKTETMNVVIETNKMLREEKERLEQELQQMQAKVRKLELDILPLQESNAELSEKS
GMLQAEKKLLEEDIKRWKARNQHLASQQKEPDLEECRKLLSEKEVNTKRIQQLTEETGRL
KAEIARSNASLTTSQNLIQNLREELNKMRTEKETLQKDLEAKVADIQEKVKTITQVKKIG
RRYKTQYEELKAQHDKVMETSQSSGELLEQQVSVHEVQELKETLNQAEIKTKSLENQIEN
LQKTVSEKEAEARSLQEQITQLQSELSRLHQDLQDRTTQEEQLRQHMTEKEDKTRKALVA
AKAKLAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRMTALKSQYEGRISRLERELRE
QQERHLEQRDEPQETTSKVPEQQRQITLKTTPASGERGIASTSDPPTANIKPTPVVSTPS
KVTAAAIAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVESQEAMQSEGPVDHVP
VFGSTSGSVRSTSPNVQPSISQPILTVQQQTQATAFVQPTQQSHPQIEPASQELSPSIVE
VVQSSPIERPSTSTSVFGTVSATPSSSLPKRAREEEDDSTTETSEQVSDETIDMPLSKKL
KSIPPVGPEEEVAAEESTDGEVEPLVNQDSQDSIGEGVTQGDYTPMEDSEETSQSLQIDL
GPLQSDQQTSISCQDAQSKGDDVIVIDSDDEDDDDDENDGEQEDYEEDDDEDDDDDDEDT
GMGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESTGGEISQRAADSQNGGEG
TSLTESSLPHENSREQQPSSASERQGPRAPQSPRRPPHPLPPRLTIHAPPQELGPPVQRI
QMTRRQSVGRGLQLTPGIGGMQHFFDDEDRTVPSTPTLVVPHRTDGFAEAIHSPQVAGVP
RFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEESGGRSVPTTPLQVAAPV
TVFTESTTADASEHASQSVPMVTTSTGSLSTTAETGTGDDGDEVFVETEPEGISSEAGLE
IDSQQEEEPVQASDESDLPSTSQDPPSSSSADTSSSQPKPFRRVRLQPQTLRTGVRGRQF
NRQRGVTHAMGGRGGLNRGNIN
NT seq 7089 nt   +upstreamnt  +downstreamnt
atggcggcggtgctgcagcaggtcctggagcggcaggagctgaccaaactgcccaagccc
gtccaggccaaattggagaagttcctggcggaccagcagagcgaaatcgactgtctgaag
ggacgacacgaaaagttcaaggtggaaagcgaacaacaatactttgaggtagagaagcgg
ctgtcccagtctcaagagagacttgtaaatgaaagccgagaatgccaaatattgcgtcaa
gaactggaaaaacttaatcaacaattgaagtcagtgactgagaaaaacaaagaattggaa
actgcgcaagatcgacatgttgctattcagagtcaacttacaagagcaaaggaggaattg
gaagctgagaaaagagatttggtcagaaccagtgaaagacgttcacaagaacttgaatat
ttaactgaggatgttaagcgcctaaatgaaaaactcaaggaaagcaatacctcaaaagga
gagctacagttaaaattagatgaacttcaagcatctgatgtttctgttaagtatcgagag
aaacgtttggaacaagaaaaggaattattacataatcagaacacatggctgaatacagag
ctaaaaaccaaaactgatgaacttctggctgttggtagagaaaaaggaaatgaaatcctg
gaacttaaatgtaatcttgaaaacaaaaaagaagaggtttccagaatggaggaacaattg
aatggcttgaaaacatcaaatgaccatctacaaaaacatgttgaagaccttctgaccaaa
ttgaaagaggccaaggagcagcaggccaatatggaagaaaaatttcacaatgagttaaat
gctcacatgaaactctctaatttgtataagagtgctgctgatgattctgaagcaaaaagc
aatgagctaactggagcagtggatgagcttcacaagcttttaaaagaagctggagaaact
aacaagggaatgcaagaccatttaatggaagtggaagaatcaaaagcccaaatggaaaaa
gaaatgctagagaaaatttgcaaattagagagagaactagagaatgctaatgatctactt
tcagccacaaaacggaaaggggccatattatctgaagaggaacttgcagctatgtctcct
actgcagcagctgtagctaaaatagtgaaacctggaatgaaattaactgagctatacaat
gcatatgtagaaacacaagatcaactgctcctagagaagctggagaataagagaattaat
aaatatctagatgaaatagtaaaagaagttgaagcaaaagcaccaattctaaaacgccaa
cgtgaggaatatgaacgtgcccaaaaggctgtggcaagtttatctgttaagcttgagcaa
gcaatgaaggaaatacagcgattgcaagaggacactgataaagccaacaaacattcatct
gtacttgaaagggacaaccaaagaatggaaatacaagtgaaagatctatcacaacagatt
agagttcttttgatggaacttgaagaggcaaggggtaatcatgtaattcgtgatgaagaa
gtaagttctgctgacatcagtagttcatctgaagttatatcacagcatctagtctcctac
agaaatattgaagaacttcagcaacagaatcagcgccttttagtagcccttagggagctt
ggggagacaagagaaagagaagaacaagaaacaacttcttcaagaattactgaacttcaa
attcagcttgagagtgccctcactgaattggaacaacttcgtgaatcccgacaccatcag
atgcaacttgttgattcaatagtccgtcagcgtgacatgtatcgtattttgttgtcgcag
acaaccggagttgttattccattgcaagcttcaagcttagaggagatttccctagtgtcc
acaccaaagcattcttcaggtgtgtcacagaccatctccactcctgctccagtttccaca
gttgagtcaacagaggcaatagaggccaaggctgcactcaagcagttgcaggaaattttt
gaaaactacaaaaaagaaaaggtagaaaatgataaaattcaaaatgaacaagttgagaaa
cttcaggagcaagttacagatttacggtcacagaataccaagatttctactcaactagat
tttgcttctaaacgctatgaaatgctacaagataatgtcgagggatatcgtcgagaaatt
acatctttacatgagagaaaccaaaaactcactgcaacaactcaaaagcaggagcagatc
atcaatacaatgactcaagatctaagaggagcaaatgagaagttggcagttgcagaagta
agagcagaaaatttgaaaaaggaaaaggaaatgttgaaattgtcagaagttcgtctctcg
caacagagagaatctttgttagctgaacaaagaggacaaaacttattactaactaacctg
caaacaattcagggaatactggagagatctgaaacagaaactaagcagagacttaataac
cagatagaaaagcttgaacgtgaaatatctcagctaaagaagaaattagaaaatgaagta
gaacaaagacacacacttacaagaaatcaggatgttcatcttttagatacaaagagacag
ctagagactgaaataaaccgtcaccttaatacaaaagaattactaaaaaatgctcaaaag
gaagctgctacattgaaacaacaactcaataatgttgaagcccagcttgcttcccagtca
gcacagagagctcctggaaaaggtcagcctaatactaaagaagacatagatgatctgatc
agtcaactaaggcaagctgaagagcagattaatgatctgaaagaaagactcaagacaaca
tctagtaatgtagaacagtatcgagctatggttcttagcttagaagaatccctaaacaag
gaaaaacaagtgacagaagaggtacgtaaaaatattgaagcccgtttaaaagactcagct
gagtatcaggcacaactggaaaaaaaattaatggaagcagagaaggaaaaacaagaactt
caggatgaaaagcgcagagctcttgaaagtatggagcagcagctatctgaattaaagaag
actctctctaatgttcaaaatgaagttcaagaagctcttcagagagcaagcacagctttg
agtaatgagcagcaagccagacgtgattgtcaggagcaggctaaaatagcaatagaggct
cagaataaatatgaacgggaactgatgctacatgctgctgatgtggaagctttgcaggct
gctaaagaacaagtctctaaaaatttactagtgcgtcagcagttggaagaaacggctcag
aaagcagaatcacagttgttggaatgcaaagcctcttgggaggaaagagagagaatgtta
aaggatgaagctgccaagtgtgtgtctcgctgtgaagacttagagaaacaaaatacatta
cttcatgatcagattgaaaaattaagtgacaaggttgtgacttctatgaaagaaggtgtg
caagggtcattaaatgtttctctaaatgaagaaggcaagtctcaagaacaaatcttagaa
attctcaggtttatacggcgagaaaaagaaattgcagaaaccaggtttgaagtagcccag
gtagaaagtttgcgttacagacaacgggtagagctcctagagagagagcttcaggagctg
caggatagtctaaatgctgagagggagaaagtccaggtaactgcaaaaacaatggctcag
catgaagaactgatgaaaaaaactgaaacaatgaatgtagttatagaaaccaacaaaatg
ctgagggaagaaaaagaaaggctggaacaagaactacaacagatgcaagcaaaggtcagg
aaactggaattagatatcttgccattacaagaatcaaatgctgaactgagtgagaaaagt
ggtatgttgcaagcagaaaagaagttgctagaagaagatatcaaacgctggaaagcacga
aaccagcatcttgcaagccagcaaaaagagccagatttggaagaatgtcgaaagctcctt
tcagagaaggaagtaaatactaaacgcattcaacagttgactgaagaaactggaagactt
aaagcagaaattgcaaggtcaaatgcatctttgaccactagccaaaatttaattcagaac
ctaagggaagaattaaataaaatgagaactgaaaaggaaactctccagaaggacttagaa
gccaaagtagctgatatacaagaaaaagtcaaaactattactcaagtcaagaaaattgga
agaagatataagactcaatatgaagagcttaaagcacaacatgataaggtaatggagact
tctcagtcttctggagaactactggaacaacaagtatctgtccatgaagtgcaagagctc
aaagaaactctgaatcaagctgaaataaaaacgaaatctctagaaaaccaaatcgagaac
cttcagaagacagtatctgaaaaagaggctgaagctagaagtcttcaggagcagataacg
caacttcagtctgaactgtcacgtcttcatcaagatctccaagacagaactacacaggag
gagcagctgcgacaacatatgacggaaaaagaagacaaaaccagaaaggctcttgttgca
gccaaagcaaagctggcacatttagctggtgtcaaagatcagctaactaaagaaaacgaa
gagcttaaacaaagaaatggtgcattagatcaacagaaggatgagctggatgtccgtatg
actgctcttaaatcacagtatgaaggtcgaattagccgcttggaacgagaactcagggaa
cagcaagaaagacatcttgagcaaagagatgagcctcaggaaactactagcaaggtccct
gaacaacaaagacagatcaccctcaaaacaactccagcttcaggtgaaagaggaattgct
agtacatcagatccaccaacagccaatatcaagccaactcctgttgtatctactccaagc
aaagtgacagctgctgccatagctgggaataaatcaacaccaagagctagtatccgacct
atggttacacctgcaacagttacaaatccaaccactactccaacagctacagtgatgccc
acaacacaggtggaatctcaggaagctatgcagtcagaaggacctgtggatcatgttcca
gtttttggaagcacaagtgggtctgttcgttctaccagtcccaacgtccaaccctctatt
tcccaacctattttaactgttcagcaacaaacacaggctacagcctttgtgcagcccact
cagcaaagtcatcctcaaattgagcctgctagccaagaactttcccccagcattgtagaa
gttgtacaaagttcaccaattgaaagaccttccacttcaacatcagtgtttggtacagtt
tcagctactccaagttcatctttgcctaaacgtgcacgtgaagaagaagatgatagcacc
acagagacatcagaacaagtctctgatgaaacaatagatatgcctctctcaaagaaattg
aagagcataccccctgtaggacctgaggaagaagttgcagcagaagagagcactgatgga
gaggtcgagccccttgtaaatcaggattcacaagattctattggagaaggagtcactcag
ggagattatacacctatggaagacagtgaagaaacttctcaatcccttcaaatagatctt
ggacccctacagtcagatcaacagacttcaatctcttgccaggatgctcagtccaaagga
gatgatgtcattgtgatagacagtgatgatgaagacgatgatgatgatgaaaatgatggt
gaacaagaggactatgaggaggatgatgatgaagatgatgacgacgatgatgaagataca
ggaatgggagatgaaggtgaagatagtaatgaaggcactggtagtgcagatggcaatgat
ggctatgaagctgatgatgctgagggtggtgatggtactgatccaggtactgaaacagaa
gaaagtacaggaggtgaaattagccagagagctgcagattctcaaaatggtggtgaagga
acttctcttacagaatcatctttgccccatgagaattctagagaacaacaaccatcatca
gcatctgaaagacagggtcctcgggcacctcagtcacctcgaagaccacctcatccactt
cccccacgactaactatccatgcacctcctcaggagttgggaccaccagtccagagaatt
caaatgacacgaagacagtcagttggacgaggacttcagctaactcctggcataggtggc
atgcagcacttttttgatgatgaggaccgaactgtgccaagtacaccaactcttgtggta
ccacatcgtacagatggatttgcagaagcaattcattcgccccaggttgctggtgttccc
agattccgatttggaccccctgaagacatgccacaaacaagttctagccattcagatctt
ggtcagcttgcatctcaaggaggtttaggtatgtatgaaacacccctcttcttagcacat
gaagaagaatctggtggccgaagtgttcctactactcctctacaagttgcagctccagtg
actgtatttactgaaagtactactgctgatgcttctgagcatgcatctcagtctgttcca
atggtgacaacatccaccggcagtttgtccacgactgcagaaactgggacaggtgatgat
ggagatgaagtatttgtggagacagaacctgaaggaattagttcagaagctggcctagaa
attgatagccagcaggaggaagaacctgttcaggcatctgatgagtctgatcttccttct
actagccaagatcctccgtccagttcctctgcagatactagcagtagtcaacctaagcct
ttcagacgagttaggcttcagcctcagactttaagaacaggagtccggggtcgtcagttt
aaccgacaaagaggtgtgacccatgcaatgggaggcagaggaggactaaacagaggaaat
attaattaa

DBGET integrated database retrieval system