KEGG   Sarcophilus harrisii (Tasmanian devil): 100926666
Entry
100926666         CDS       T02286                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04012  ErbB signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04115  p53 signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04218  Cellular senescence
shr04630  JAK-STAT signaling pathway
shr04921  Oxytocin signaling pathway
shr04928  Parathyroid hormone synthesis, secretion and action
shr04934  Cushing syndrome
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05212  Pancreatic cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05216  Thyroid cancer
shr05217  Basal cell carcinoma
shr05218  Melanoma
shr05219  Bladder cancer
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100926666 (CDKN1A)
   04630 JAK-STAT signaling pathway
    100926666 (CDKN1A)
   04066 HIF-1 signaling pathway
    100926666 (CDKN1A)
   04068 FoxO signaling pathway
    100926666 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    100926666 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100926666 (CDKN1A)
   04115 p53 signaling pathway
    100926666 (CDKN1A)
   04218 Cellular senescence
    100926666 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100926666 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    100926666 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100926666 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    100926666 (CDKN1A)
   05206 MicroRNAs in cancer
    100926666 (CDKN1A)
   05205 Proteoglycans in cancer
    100926666 (CDKN1A)
   05203 Viral carcinogenesis
    100926666 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100926666 (CDKN1A)
   05212 Pancreatic cancer
    100926666 (CDKN1A)
   05225 Hepatocellular carcinoma
    100926666 (CDKN1A)
   05226 Gastric cancer
    100926666 (CDKN1A)
   05214 Glioma
    100926666 (CDKN1A)
   05216 Thyroid cancer
    100926666 (CDKN1A)
   05220 Chronic myeloid leukemia
    100926666 (CDKN1A)
   05217 Basal cell carcinoma
    100926666 (CDKN1A)
   05218 Melanoma
    100926666 (CDKN1A)
   05211 Renal cell carcinoma
    100926666 (CDKN1A)
   05219 Bladder cancer
    100926666 (CDKN1A)
   05215 Prostate cancer
    100926666 (CDKN1A)
   05213 Endometrial cancer
    100926666 (CDKN1A)
   05224 Breast cancer
    100926666 (CDKN1A)
   05222 Small cell lung cancer
    100926666 (CDKN1A)
   05223 Non-small cell lung cancer
    100926666 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100926666 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100926666 (CDKN1A)
   05161 Hepatitis B
    100926666 (CDKN1A)
   05160 Hepatitis C
    100926666 (CDKN1A)
   05163 Human cytomegalovirus infection
    100926666 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100926666 (CDKN1A)
   05169 Epstein-Barr virus infection
    100926666 (CDKN1A)
   05165 Human papillomavirus infection
    100926666 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100926666 (CDKN1A)
   01522 Endocrine resistance
    100926666 (CDKN1A)
SSDB
Motif
Pfam: CDI Arm_vescicular
Other DBs
NCBI-GeneID: 100926666
NCBI-ProteinID: XP_031820832
Ensembl: ENSSHAG00000011573
LinkDB
Position
4
AA seq 164 aa
MSESPSRTRQIPCSGKLCRNLFGPVDHEQLKQDCQDLMQSCTQEAQRRWNFDFITETPLE
GDYAWERVRGLDLPSIYRPTGPWGREDLGGKRPKPRPSSPALLQMSAQGDHVDLSLSCTV
VPLTPEREEGSMAGTSQPTRKHKQTSMTDFYHSKRRLIFYKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtctgagtcaccgagtcgaacacgtcagatcccctgcagtgggaaactttgccggaac
ctctttgggcctgtggaccacgagcagctgaagcaagactgccaggacctgatgcagagc
tgcacccaggaggcccagcgccgatggaacttcgacttcatcactgagacccccctagaa
ggcgattatgcctgggagagggtccgaggcctggatctaccctccatatatcgcccgacg
gggccatggggcagggaggacctgggggggaagaggccaaagccccggcccagctcccca
gccctgctacagatgtccgcccagggagaccatgtggatctatccctctcctgcactgta
gtaccactgaccccagagcgagaggaagggtctatggctgggacctcccaaccaacccga
aaacacaagcagaccagcatgacggatttctaccattcaaagcgaaggctcatcttctac
aagagaaagccatga

DBGET integrated database retrieval system