KEGG   Sarcophilus harrisii (Tasmanian devil): 100926708
Entry
100926708         CDS       T02286                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha isoform X3
  KO
K08524  retinoid X receptor alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03320  PPAR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04659  Th17 cell differentiation
shr04919  Thyroid hormone signaling pathway
shr04920  Adipocytokine signaling pathway
shr04928  Parathyroid hormone synthesis, secretion and action
shr04932  Non-alcoholic fatty liver disease
shr04976  Bile secretion
shr05160  Hepatitis C
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05216  Thyroid cancer
shr05222  Small cell lung cancer
shr05223  Non-small cell lung cancer
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100926708 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100926708 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100926708 (RXRA)
   03320 PPAR signaling pathway
    100926708 (RXRA)
   04919 Thyroid hormone signaling pathway
    100926708 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    100926708 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    100926708 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100926708 (RXRA)
   05202 Transcriptional misregulation in cancer
    100926708 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    100926708 (RXRA)
   05216 Thyroid cancer
    100926708 (RXRA)
   05222 Small cell lung cancer
    100926708 (RXRA)
   05223 Non-small cell lung cancer
    100926708 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100926708 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100926708 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100926708 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:shr03310]
    100926708 (RXRA)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100926708 (RXRA)
Nuclear receptors [BR:shr03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100926708 (RXRA)
SSDB
Motif
Pfam: Nuc_recep-AF1 Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100926708
NCBI-ProteinID: XP_012409469
Ensembl: ENSSHAG00000015645
LinkDB
Position
2
AA seq 467 aa
MDTKHFLPLDFSTQVNSTSLNSPTGRGSMAAPSLHPSIGPGLGSSLGSSSQLHSPISTLS
SPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKPPLGLNG
VLKVPAHPSGTMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSANEDMPVEKI
LEAELAVEPKTETYIEANMGLNPNSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
KMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPDQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggacaccaaacatttcctgccgctggatttttccacccaggtcaattccacatccctg
aattcccccactggcagagggtccatggctgccccctccctgcacccgtccattggcccc
ggccttggctcgtccctcggatcatccagccagctgcactcccccatcagcactctgagc
tcccccattaatggcatgggccctcccttctctgtcatcagctcccccatggggcctcac
tcaatgtctgttcccacaacccccacccttgggtttgggaccggcagcccccagctcaac
tcgccaatgaaccctgtcagcagcacagaagatattaagccacctcttgggctcaatgga
gttcttaaagtgcccgcccatccctcaggaaccatggcctccttcaccaagcacatatgt
gccatctgtggggaccgctcctcaggtaaacattatggtgtgtacagttgtgaaggctgc
aaaggcttcttcaagagaacggtccgcaaggacctcacctacacctgccgagataataag
gactgcctgattgacaaacgccagaggaaccggtgccaatactgccgctaccagaagtgt
cttgccatgggcatgaagcgagaagctgtgcaagaagagaggcagaggggcaaagaccgg
aatgagaacgaggtggaatcaaccagtagtgctaatgaggacatgccagtggaaaagatc
ttggaagctgaactcgctgtggagccaaagacagagacgtacattgaggcaaacatggga
ctgaatcccaattcgcccaacgaccccgttaccaacatttgccaagcagcagacaaacag
ctcttcaccttggtggaatgggccaagagaatcccccacttctcagaactacccctggat
gaccaggtcattctattgcgagcgggctggaatgaactgctcatcgcctcgttctctcac
cgctcgatagcagtgaaagatgggatccttcttgccaccggcctccacgtccataggaac
agcgctcacagtgcaggggtgggcgccatctttgacagagtcctgacagaacttgtgtca
aaaatgcgagacatgcagatggacaagacagagctgggctgcctgagagccattgtcctc
ttcaaccctgactctaaaggactttccaaccctgcggaagtagaagccctacgagagaaa
gtttacgcttccctcgaagcctactgcaaacacaagtatccggaccagcctgggaggttc
gccaagctcttgctccgtctccccgctctccggtccatcggtctgaaatgcttggagcac
ctcttcttcttcaagctaataggagatacccccattgacaccttcctgatggagatgttg
gaggcaccccaccaaatgacatag

DBGET integrated database retrieval system