KEGG   Sarcophilus harrisii (Tasmanian devil): 100926733Help
Entry
100926733         CDS       T02286                                 

Gene name
ERG
Definition
(RefSeq) transcriptional regulator ERG isoform X2
  KO
K09435  transcriptional regulator ERG
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05202  Transcriptional misregulation in cancer
shr05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100926733 (ERG)
  09162 Cancer: specific types
   05215 Prostate cancer
    100926733 (ERG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100926733 (ERG)
Transcription factors [BR:shr03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100926733 (ERG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT SAM_2 SAM_3 SAM_1
Motif
Other DBs
NCBI-GeneID: 100926733
NCBI-ProteinID: XP_012399786
Ensembl: ENSSHAG00000008486
LinkDB All DBs
Position
3
AA seq 386 aa AA seqDB search
MVNSQDNVGMNYGNFLEEKHILSTNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGL
PDVDILLFQNIDGKDLCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKAL
QNSPRLMHARNTGGATFIFPNTSVYPESTQRIASRPDLPYEAARRSTWTSHSHPTQSKVT
QPSSSTVPKTEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSNCITWE
GTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFH
GIAQALQPHPPESSLYKYPSDLPYMGSYHAHPQKMNFVAPHPPALPVTSSSFFSAPNPYW
NSSTGSIYPNTRLPASHMPSHLGTYY
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggtcaacagccaagataatgttggaatgaattatggcaactttttggaggagaagcat
attctatcaaccaacatgacaacaaatgaacgaagggttattgtacctgcagatcctaca
ttatggagcacagaccacgtccggcaatggctagaatgggcagtgaaagaatatggtctt
ccagatgtcgacatcttattgttccagaacatagatgggaaggatctgtgcaagatgacc
aaagatgatttccaaagacttactccaagttataatgctgatattcttctctcccatctt
cactacctcagagagactcctcttccacatttgacttcagatgatgttgataaagcctta
caaaactctccacggttaatgcatgctagaaacacaggaggggccacttttattttccca
aatacttcagtatatcctgaatccacacaaagaattgcatctaggccagatttaccatat
gaagcagccaggagatcaacctggacaagtcatagtcaccctacacagtcaaaagttact
cagccatcttcttcaacagttcccaaaacagaagaccagcgtccccagttagatccatat
cagattcttggaccaacaagtagtcgtcttgcaaatcctgggagtggacagatacagctt
tggcaattccttctggagcttctatctgacagctcaaattccaactgcatcacttgggaa
ggaaccaatggagaattcaagatgacagaccctgatgaagttgcccgtcgctggggagaa
cgcaaaagcaaacctaacatgaactatgataagcttagtcgtgcattacgttactactat
gacaaaaatattatgactaaagttcatggcaagcgttatgcttataaatttgacttccat
ggaattgctcaggcattacagcctcatcctcctgagtcttctttgtacaaatatccatca
gacctcccttatatgggctcctatcatgctcatcctcagaagatgaactttgttgctcct
catcctcctgctttgcctgtgacatcttccagtttcttctctgcccctaatccatactgg
aattcatcaactggaagtatctaccccaataccaggcttccagccagccatatgccttcc
catttggggacttactactaa

DBGET integrated database retrieval system