KEGG   Sarcophilus harrisii (Tasmanian devil): 100926756
Entry
100926756         CDS       T02286                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00590  Arachidonic acid metabolism
shr01100  Metabolic pathways
shr04064  NF-kappa B signaling pathway
shr04370  VEGF signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04657  IL-17 signaling pathway
shr04668  TNF signaling pathway
shr04723  Retrograde endocannabinoid signaling
shr04726  Serotonergic synapse
shr04913  Ovarian steroidogenesis
shr04921  Oxytocin signaling pathway
shr04923  Regulation of lipolysis in adipocytes
shr05010  Alzheimer disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05140  Leishmaniasis
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05200  Pathways in cancer
shr05204  Chemical carcinogenesis
shr05206  MicroRNAs in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100926756 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100926756 (PTGS2)
   04064 NF-kappa B signaling pathway
    100926756 (PTGS2)
   04668 TNF signaling pathway
    100926756 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100926756 (PTGS2)
   04657 IL-17 signaling pathway
    100926756 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100926756 (PTGS2)
   04913 Ovarian steroidogenesis
    100926756 (PTGS2)
   04921 Oxytocin signaling pathway
    100926756 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    100926756 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100926756 (PTGS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100926756 (PTGS2)
   05206 MicroRNAs in cancer
    100926756 (PTGS2)
   05204 Chemical carcinogenesis
    100926756 (PTGS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100926756 (PTGS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100926756 (PTGS2)
   05022 Pathways of neurodegeneration - multiple diseases
    100926756 (PTGS2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100926756 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100926756 (PTGS2)
   05165 Human papillomavirus infection
    100926756 (PTGS2)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100926756 (PTGS2)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100926756 (PTGS2)
SSDB
Motif
Pfam: An_peroxidase EGF EGF_2 hEGF
Other DBs
NCBI-GeneID: 100926756
NCBI-ProteinID: XP_003767572
Ensembl: ENSSHAG00000016171
LinkDB
Position
4
AA seq 669 aa
MRDAFATGGSRVISSRGELDCLKIERRPGTQLVPKSKSKSKSKSDWKTRGLSLLAIAPPS
AVMMKRIAFLFIFSTAALALSQAANPCCSNPCQNRGICMTTGIDRYQCDCTRTGFYGENC
TTPEFLTRIKLMLKPTPDTVHYILTHFKSVWNIVNNIPFLRDFVMRYVLTSRSNLIESPP
TYNVHYGYKSWEAFSNLSYYTRALPPVRDDCPTPMGVKGKKQLPESKEVVEKCLLRRKFI
PDPQGTNMMFAFFAQHFTHQFFKTDHHRGPAFTKALGHGVDLNHIYGENLERQYKLRLFK
DGKMKYQVIDGEVYPPLVKDTQAEMIYPPHVPEHLKFAVGQEVFGLVPGLMMYATIWLRE
HNRVCDILKQEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYYFKLKFDPELLFS
QSFQYQNRIAAEFNTLYHWHPLLPDTFQIEDKEYSYQQFLYNNSVLVEHGISHMVESFSR
QIAGRVAGGKNVPLAVKKVSIASIDQSRQMKYQSLNEYRKRFMLKPFSSFEELTGEKEMA
AELEALYGDIDAMELYPALLVEKPRPGAIFGETMVELGAPFSLKGLMGNPICSPDYWKPS
TFGGDVGFEIINTASIQSLICNNVKGCPFTAFSVQDSQLKTATINASSSNSGLDDINPTV
LLKERSTEL
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgagagatgctttcgcaaccggcggaagccgagtcatctcatcacgtggggagctcgat
tgccttaaaattgagaggcggccaggcactcaactagttccgaaaagcaagagcaagagc
aagagcaagagtgactggaaaacgagaggactttccctactggcaatcgctccgccctcc
gctgtgatgatgaaaaggatagcattcttgtttatcttctcgactgctgcgctagcgctc
agccaagcagcaaacccgtgctgctcaaatccatgtcaaaaccgaggtatatgtatgaca
acaggtattgaccgataccaatgtgactgtaccagaacaggattctatggagaaaattgt
acaactcctgagtttctgacaaggataaaattgatgctaaaacccacgccagacacagtt
cactacatcctcacccacttcaagtcagtgtggaatatagtcaacaatatcccttttctg
cgggattttgtgatgagatacgtgttgacatcaagatcaaatttaattgagagcccacca
acgtacaatgttcattatggttacaaaagttgggaagccttttctaacctctcttactac
actagagctcttcccccagtgagagatgactgtccaactccaatgggtgtaaaaggtaaa
aaacaacttcctgaatccaaagaagttgtggaaaaatgtcttctgagaagaaagtttatt
cctgacccccaaggcacaaatatgatgtttgcattctttgctcaacatttcactcaccag
ttctttaaaacagatcatcacagaggcccagccttcacaaaagcactaggacatggggtt
gatttaaatcatatttatggagaaaatttggaaagacaatacaaactgcggcttttcaag
gatggaaaaatgaaatatcaggtaattgatggagaagtatatccacctttagtgaaagat
actcaggcagaaatgatctatccacctcatgttcctgagcatctgaaatttgctgttggt
caagaagtatttggcctggttccaggtttaatgatgtacgctacaatatggcttcgagag
cataaccgagtgtgtgacatccttaaacaggaacatcctgaatgggatgatgagcaattg
ttccagaccagcagactgatactgattggtgagactattaagattgtaattgaagattat
gtccaacacttgagtggttattacttcaaactgaagtttgacccagaactgctgttcagt
cagagcttccagtaccaaaaccgaattgctgctgagttcaacaccctctaccactggcat
cctctacttcctgacaccttccaaattgaggataaagagtatagttaccagcagttcctc
tacaacaactctgtattagtggaacatggaatttcccacatggtggaatcattttctagg
caaattgctggccgggttgctgggggcaagaatgtgccacttgcagtaaagaaagtttcc
attgcttcaattgaccagagcagacaaatgaaataccaatctctaaatgaatacagaaaa
cgcttcatgctcaagccttttagttcatttgaagaactgacaggagagaaagaaatggct
gcagaactggaagccctctatggtgatattgatgctatggagttgtatcctgctcttcta
gtagaaaaacctcgtccaggtgccatctttggagagaccatggtagaacttggagcaccc
ttctcactcaaaggactcatgggtaacccaatctgttcccctgactattggaagcctagc
acttttggtggcgatgtaggttttgaaattatcaatacagcctcaatccagtcactaatc
tgcaataatgtaaagggatgtcccttcactgcattcagtgttcaagattctcaactcaaa
acagcaaccattaatgccagctcatcaaactctggacttgatgacatcaatcccacagta
ctgctaaaagaacgttcaactgaactatag

DBGET integrated database retrieval system