KEGG   Sarcophilus harrisii (Tasmanian devil): 100926799Help
Entry
100926799         CDS       T02286                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00010  Glycolysis / Gluconeogenesis
shr00051  Fructose and mannose metabolism
shr00052  Galactose metabolism
shr00500  Starch and sucrose metabolism
shr00520  Amino sugar and nucleotide sugar metabolism
shr00524  Neomycin, kanamycin and gentamicin biosynthesis
shr01100  Metabolic pathways
shr01200  Carbon metabolism
shr04066  HIF-1 signaling pathway
shr04910  Insulin signaling pathway
shr04930  Type II diabetes mellitus
shr04973  Carbohydrate digestion and absorption
shr05230  Central carbon metabolism in cancer
Module
shr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
shr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100926799
   00051 Fructose and mannose metabolism
    100926799
   00052 Galactose metabolism
    100926799
   00500 Starch and sucrose metabolism
    100926799
   00520 Amino sugar and nucleotide sugar metabolism
    100926799
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100926799
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100926799
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100926799
  Digestive system
   04973 Carbohydrate digestion and absorption
    100926799
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100926799
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100926799
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100926799
Membrane trafficking [BR:shr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100926799
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 100926799
NCBI-ProteinID: XP_023351414
Ensembl: ENSSHAG00000004335
LinkDB All DBs
Position
1
AA seq 906 aa AA seqDB search
MEDDGLGKIDKYLYSMRLSDENLNEITKRFKKAMKNGLSRNYNITASVKMLPTFVRSIPD
GSEKGDFIALDLGGSSFRILRVQVSHEKHQTVQMESEVYDTPESIMIGSGSQLFDHVAEC
LGDFMEKKNIKDKNLPVGFTFSFPCRQTKIDEGVLITWTKRFKASGVEGSDVVQLLNKAI
KKRGDYEANIVAVVNDTVGTMMTCGFDDQECEVGLIIGTGTNACYMEEMQHIDMVEGDEG
RMCINTEWGAFGDDGSLNEFRTEFDKEIDRGSLNPGKQLFEKMVSGMYMGELVRLIIVKM
AKGGLLFEGRITPELLTKGKFETKHVSAIEKTKEGLQRAQEILSNLGLEPSPEDCVSVQH
VCAIVSHRSANMVAAMLAGILSRLKENKGVTRLRTTIGVDGTLYKFHPQYSRRFNKTLRR
LVPDCDVRFILSESGSGKGAAMVTAVAYRLAEQHRQMEEMLAPLKLTIEQLNQVKNRMRV
EMDLGLQKKTNESARVKMLPSFVCGTPDGTEHGDFLALDLGGTNFRVLLVKIRSGKKRSV
EMHNKIYAIPEEAMQGTGEELFDHIVSCISDFLDYMGIKGARLPLGFTFSFPCRQTSLDG
GILLTWTKGFNASNCEGHDVPTLLREAIKRREEFDLDVVALVNDTVGTMMTCAYEEPTCE
IGLIVGTGSNACYMEEMKNIEMVEGNEGRMCINMEWGAFGDNGCLEDIRTEYDRIVDDYS
LNAGRQRYEKMISGMYLGEIVRNILIDFTRKGFLFRGQISETLKTRGIFKTKFLSQIESD
RLALLQVRTILQDLGLNSTCDDSILVKMVCGVVSQRAAQLCGAGMAAVVEKIKENRGLKT
LNVAVGVDGTLYKLHPHFSRIMHQTVSKLAPNCNVKFLLSEDGSGKGAALISAVGVKLRD
AKAKAS
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgatggcctggggaagatcgacaagtacctttattccatgcggctctcagat
gaaaaccttaatgaaatcacaaaacgatttaaaaaagctatgaaaaatggcctctccaga
aattataatataactgcttcggtgaagatgctgccaacatttgtcagatccattcctgat
ggctcagaaaagggagatttcattgctctggatctcggtggatcctcctttcgaattcta
cgagtgcaagtgtctcatgagaaacatcagactgttcaaatggagtcagaggtttatgat
acacccgagagtataatgattggcagtggatcccagctttttgatcacgttgctgaatgc
ctgggtgacttcatggagaaaaagaatatcaaagataaaaatttacccgttggatttacc
ttttccttcccctgccgacagacgaaaattgacgagggtgtcctgatcacctggaccaag
cgctttaaagccagtggcgtggagggatctgatgtggtccaactgctcaacaaagcaatc
aaaaagcgaggggattacgaagccaacatcgtggctgttgtgaatgacaccgtggggaca
atgatgacctgtggctttgatgaccaggagtgtgaagtgggcttgatcattggtaccgga
accaacgcctgctacatggaggagatgcaacacatcgacatggtggaaggggacgaaggg
cgcatgtgcatcaacacggagtggggggccttcggggatgatggcagcctcaatgaattc
cgcacagagtttgacaaggagatcgatcggggttccctcaatcctggaaagcaactgttt
gagaagatggtcagcggcatgtacatgggggagctcgtcagactgattattgtgaagatg
gccaaagggggcctcctgtttgagggacggatcacacctgagcttctcaccaaagggaaa
tttgaaaccaagcatgtgtcagccattgaaaaaaccaaggaaggcctccaaagagcccaa
gaaatcctgagtaacctcggcttggaaccatcccctgaagattgcgtctctgtccagcat
gtgtgcgccatcgtgtctcatcgctcagccaacatggtggctgccatgttagccggcatc
ctgtcccgcctgaaagaaaacaaaggggtgactcggctgcggaccaccatcggtgtcgat
gggaccctttacaagttccatccacagtattcccgtcgattcaacaagaccctgcggcgc
ttggtccccgactgcgacgtgcgcttcatcctctctgagagtgggagcggaaagggggct
gccatggtgaccgctgtggcctatcggctggccgaacagcacaggcagatggaagaaatg
ctggcccccttaaagctcaccatcgagcagctcaatcaagtgaagaacagaatgcgagtg
gagatggatctcggcctgcagaagaagaccaatgaatcagccagagtgaaaatgctgccc
tcgtttgtctgcggcacccccgacgggacagaacatggagacttcctggccttggacctt
ggcggcaccaactttcgggttctgttggtgaagatccgcagcgggaagaagagaagtgtt
gaaatgcacaacaaaatctatgctatccctgaggaagcgatgcagggaactggggaggag
ctctttgaccacatcgtcagctgtatttctgacttcctggactacatggggatcaagggg
gcccggttacccctcggcttcaccttttccttcccttgcagacagacaagcttggacggg
ggcatcttgctcacgtggacaaagggatttaacgcgtccaactgtgaaggacatgacgtg
cccaccttgctgagagaagccattaagaggagagaggaatttgacctggatgtcgtggct
ttggtcaatgacacagtgggcaccatgatgacctgtgcctacgaagagccaacgtgcgag
atcggactcattgtagggaccggaagcaatgcttgctacatggaagagatgaagaatatc
gagatggtggaggggaatgaggggcggatgtgcatcaacatggagtggggtgcttttggg
gacaacggatgcctggaagacattaggacagaatatgacagaattgtagacgattattcc
ctcaatgctggcagacaaagatatgagaagatgattagtggtatgtacttgggagaaatc
gtccggaacattttaattgacttcactcgaaagggtttcctgttccgaggtcagatctct
gagaccctgaaaacccggggaatctttaagaccaagttcctgtcacagattgaaagtgat
aggttagccctgctccaagtccgaacgattctgcaggatctgggcctgaacagcacctgc
gatgacagtatcctcgtcaagatggtctgtggggtggtgtcccagagggctgcccagctc
tgtggggctgggatggcggccgtcgtggaaaagatcaaggagaatcggggcctgaagacc
cttaacgtggccgtgggagtcgatgggacgctttacaaactccatcctcacttctctcgg
atcatgcaccagacagtgagcaagctggcccccaactgtaacgtgaaattcctcctctcc
gaagatggcagtgggaaaggagcagccctcatctcggccgttggggtgaagctccgggac
gccaaggccaaggccagctaa

DBGET integrated database retrieval system