KEGG   Sarcophilus harrisii (Tasmanian devil): 100927199
Entry
100927199         CDS       T02286                                 

Gene name
PTEN
Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00562  Inositol phosphate metabolism
shr01100  Metabolic pathways
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04068  FoxO signaling pathway
shr04070  Phosphatidylinositol signaling system
shr04071  Sphingolipid signaling pathway
shr04115  p53 signaling pathway
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04218  Cellular senescence
shr04510  Focal adhesion
shr04931  Insulin resistance
shr05165  Human papillomavirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05206  MicroRNAs in cancer
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05218  Melanoma
shr05222  Small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05230  Central carbon metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100927199 (PTEN)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100927199 (PTEN)
   04070 Phosphatidylinositol signaling system
    100927199 (PTEN)
   04071 Sphingolipid signaling pathway
    100927199 (PTEN)
   04151 PI3K-Akt signaling pathway
    100927199 (PTEN)
   04150 mTOR signaling pathway
    100927199 (PTEN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100927199 (PTEN)
  09143 Cell growth and death
   04115 p53 signaling pathway
    100927199 (PTEN)
   04218 Cellular senescence
    100927199 (PTEN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100927199 (PTEN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100927199 (PTEN)
   05206 MicroRNAs in cancer
    100927199 (PTEN)
   05230 Central carbon metabolism in cancer
    100927199 (PTEN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100927199 (PTEN)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100927199 (PTEN)
   05214 Glioma
    100927199 (PTEN)
   05218 Melanoma
    100927199 (PTEN)
   05215 Prostate cancer
    100927199 (PTEN)
   05213 Endometrial cancer
    100927199 (PTEN)
   05224 Breast cancer
    100927199 (PTEN)
   05222 Small cell lung cancer
    100927199 (PTEN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100927199 (PTEN)
   05165 Human papillomavirus infection
    100927199 (PTEN)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100927199 (PTEN)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100927199 (PTEN)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100927199 (PTEN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:shr01009]
    100927199 (PTEN)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100927199 (PTEN)
    3.1.3.48  protein-tyrosine-phosphatase
     100927199 (PTEN)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     100927199 (PTEN)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    100927199 (PTEN)
SSDB
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 DUF3256
Other DBs
NCBI-GeneID: 100927199
NCBI-ProteinID: XP_031812845
Ensembl: ENSSHAG00000003709
LinkDB
Position
2
AA seq 404 aa
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDATKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSH
LLKHHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYTSPSGPTRREDKYMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEENSDKVENGSLCGDQE
IDSIGSAERSDNDKEYLILTLSKNDLDKANKDKANRYFSPNFKVKLFFTKTVEEPANPEA
SSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITKV
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgacagccatcatcaaggagatcgtgagcagaaacaaaaggagataccaagaggatgga
ttcgacttggacttgacctatatttatccaaacatcattgctatggggtttcctgcagaa
agacttgaaggcgtatacaggaacaacatcgatgatgtagtcaggtttttggattcaaaa
cataaaaatcattacaagatatacaatctatgtgctgaaagacattatgatgccaccaaa
tttaactgtagagttgcacagtatccttttgaagaccacaacccgccccagctagagctc
atcaaacctttttgtgaggatctcgaccagtggctaagtgaagatgacaatcatgttgca
gcaattcactgtaaagcaggaaagggacgaactggtgtaatgatttgtgcatatttatta
catcgaggaaagttcttaaaggcacaagaggctctagatttctatggggaagtcaggacc
agagacaaaaagggagtgactattcccagccagaggcgctatgtgtattactatagtcac
ctgttaaagcaccatttggattacagaccagtggccctgctctttcacaagatgatgttt
gaaacaattccaatgttcagtggtggaacttgcaatcctcagttcgtggtctgccagctg
aaggtgaagatctacacctccccttcagggcccacaaggcgggaagacaagtacatgtac
tttgaattcccccagcctttgccggtgtgcggtgacattaaggtggaattcttccacaag
cagaacaagatgctcaagaaggacaaaatgtttcacttttgggtaaatacattcttcata
ccaggaccagaggaaaactcagacaaagtagaaaatggaagtctttgtggtgatcaagag
attgatagtattggcagcgccgagcgatcagataatgacaaagaatatctcatactcaca
ttatccaaaaacgatcttgacaaagcgaataaagacaaggccaacagatacttttctcca
aactttaaggtgaagcttttcttcacaaaaactgtagaggagccggcaaacccagaggcc
agcagttccacttcagtcaccccggacgttagtgacaatgaacctgatcattatagatac
tcggacaccactgactctgatccagagaacgagccttttgatgaagatcaacacacacag
atcacaaaagtctga

DBGET integrated database retrieval system