KEGG   Sarcophilus harrisii (Tasmanian devil): 100927200
Entry
100927200         CDS       T02286                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04020  Calcium signaling pathway
shr05200  Pathways in cancer
shr05216  Thyroid cancer
shr05223  Non-small cell lung cancer
shr05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100927200 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100927200 (RET)
   05230 Central carbon metabolism in cancer
    100927200 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100927200 (RET)
   05223 Non-small cell lung cancer
    100927200 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100927200 (RET)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100927200 (RET)
Protein kinases [BR:shr01001]
 Receptor tyrosine kinases (RTK)
  RET family
   100927200 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD3 RET_CLD4 Pkinase Cadherin RIO1 Pkinase_fungal Cadherin_pro
Other DBs
NCBI-GeneID: 100927200
NCBI-ProteinID: XP_031812239
LinkDB
Position
2
AA seq 1105 aa
MSLRGGLVGLLLLCEAVLGLYFSRDTYSEKLYIDEPVGTPLLYVHALQDARGEVPHFRLG
QHLYSTYRSQPHKNDWFQINEDTGLLYLNQSLDQRALEKLSARNGGFPLLTIYLQVFLSP
KPLRESDCHWPSCAKVMLSVINTTMPACSSLKPREFCFLETGLSFRIRENKPPGTFHQFR
LLPVQHLCPNISISYQLLGEEALPFYSDKDTMEVNMRHSLDREEKEKYELIAKCTVWEGL
REEVVMVPFPVTVYDEDDSPPNFPNGINTANAVVEYKRKEGTVLAVLQVFDADVVPSSVD
IPRKYIHTMLTSDPLVNEFFRVEHSPNETSYNSNGSRVRAMMHDYKLVLNRSLPITESHS
FQLGVLVNDTDYQGPGGVLHLYFNVTILPVSIRFPNISYSFSVNRNAHRYAQIGKVCIEN
CKEFHGVNITYKLQSLSVNCTALGIITTPESTTGNLFVNDTSMLQRPECTGMKYLVIASD
RQSKKQSRTTSTISVEGNFFPEEEGCPISCAVNKRRSECEECGGLGTLMGTCQWRQGDGK
GISKNYSTCTPSLKTCPDGNCDAVESRDLHICPQDCIRGDIIGGHERGEWRGIKAGYGVC
NCFPEKKKCFCEPDDDKEPLCDEVCRMVIAVAVLFSFIFSVLLSSYFIRRYHKNSHKPPI
ASAEMTFRRPAQAYPISYSSSNVRRPSLDSMENQVSVDAFKIPEDPKWEFPRKNLVLGKT
LGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASPSELKDLLSEFNLLKQVNHPHVIK
LYGACSQDGPLYLIVEYAKYGSLRSFLRESRKVGPSYMGGNGNRNSSYLDNPDERALTMG
DLISFAWQISRGMHYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDSYVKRS
KGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGYR
MERPENCSEEMYNLMLHCWKQEPDKRPTFGEISKDLEKMMVKSRDYLDLAASTPSDSLLY
DDGLSEEETPLVDCNNAPLPRTLPSTWIENKLYGMSYPNWPEESPVPLTRFDGTNSVFSR
YANDSVYANWMVSPSAAKLMDKFNS
NT seq 3318 nt   +upstreamnt  +downstreamnt
atgtctcttcgcggggggctcgtggggcttctccttctttgtgaagctgtgttgggtctt
tatttttctcgggacacttactcagaaaaactatacattgacgaacctgttggaacaccc
ctgctctatgttcatgccttacaagatgccagaggggaggtgccacacttccgcctgggc
cagcatctctatagtacctatcggtctcagccgcacaagaatgactggttccagatcaat
gaagatacaggccttctctacctcaaccaaagtctggaccaaagggccttggagaaactg
agtgcccgaaatggaggatttcccctactcaccatctaccttcaagtattcctctcacca
aagccattacgggagagtgattgccattggcccagctgtgccaaagtgatgctgtctgtc
atcaataccaccatgccagcctgcagttctctgaagcctagggaattctgctttttggag
acagggctctcatttcgcatcagggagaataagccaccgggtactttccaccaattccgt
ttacttcctgtgcagcatctgtgtccaaatatcagcatttcctaccaattgcttggagaa
gaagcccttcccttctattctgataaggacaccatggaggtgaacatgaggcactcactg
gaccgggaagaaaaggagaagtatgaattgattgccaagtgcacagtttgggaaggtttg
cgagaagaggttgtgatggtgccctttcctgtgactgtatatgatgaagatgattcacct
cctaatttccccaatggcatcaacacagctaatgcagttgtggagtacaaacggaaagag
ggtacagtattggctgtcctgcaggttttcgatgcagatgtcgtgccttcctctgtggac
atcccaagaaagtacatacataccatgctgaccagtgaccctttggtcaatgagttcttc
cgggtggaacactcaccaaatgaaacttcatacaactctaatggaagtcgtgtgcgggcg
atgatgcatgattacaaactggtgctcaaccgaagccttcctatcacagagagccattct
ttccagctgggagtcctggtgaatgacactgactaccagggtcctggaggagtactccat
ctctatttcaatgtgaccatcctgcctgtcagcatacggtttccaaacatctcctattcc
ttctcagtaaatcggaatgctcaccgatatgcacagattggaaaagtttgcattgaaaac
tgcaaggagttccatggagtaaatattacctacaaactacagtcactcagtgttaattgc
accgctctgggcatcatcaccaccccagaaagcacaacagggaatctgtttgtgaatgac
acctctatgctgcagagaccggaatgcacaggaatgaaatatttggtaattgcatcagac
agacagagcaagaaacaatccagaacaacatctactatctcagtagaaggaaattttttc
cctgaggaggagggctgtcccatttcatgtgcagtgaacaagagacgttcagaatgtgaa
gaatgtggtggcttgggcaccctgatgggcacatgccagtggagacaaggagatggcaaa
ggaatttccaagaactattcgacttgcactccaagcctcaagacttgtcctgatggcaac
tgtgatgcagtagaaagtcgagatcttcatatctgccctcaagattgcatacggggagac
attattggtggtcatgagagaggagaatggaggggaatcaaggctggatatggagtctgc
aactgctttccagaaaaaaagaagtgtttctgtgagccggatgatgataaagaaccgctt
tgtgatgaagtctgcagaatggtcattgccgtagccgtacttttctccttcatcttctct
gtgctgctctcttcctacttcatccgtcgctaccacaagaactcccacaagccacccatt
gcctctgcagagatgaccttcaggaggcctgctcaggcttaccccatcagctattcttcc
tccaatgttcgccggccatctttggattccatggagaaccaggtctcagtggatgccttc
aaaatccctgaggatccaaagtgggaatttcctcggaagaatttagttcttggaaaaacc
ctaggagaaggagagtttggaaaggtcgtcaaggcaacagctttccgactcaaagggaaa
gcaggctacaccactgtggcagtgaaaatgctgaaagaaaatgcttctccaagtgagctc
aaagacctgctgtcagagtttaacctgctaaaacaggtcaaccacccccacgtcattaaa
ctctatggcgcctgcagtcaggatggacctctctacttgattgtggagtatgctaagtat
ggttctctgcggagcttcctccgggaaagccggaaggtgggacccagctacatgggaggt
aatggcaatcggaattctagctacttggacaatccggatgagagggcactgaccatggga
gatctcatttccttcgcctggcagatttcccgaggaatgcattatcttgcagaaatgaag
ctggtccaccgtgatttagcagctaggaatgtcttggtggctgaaggacgcaaaatgaag
atttctgattttggcctttcccgagatgtttatgaagaggactcctatgtcaaaaggagc
aagggccggattcctgtaaagtggatggcaattgagtctctttttgatcatatctacact
acccaaagtgatgtgtggtcatttggtgtgttgctctgggaaattgtaaccctaggagga
aatccctatcctggtattcctcctgaacgtctcttcaaccttctaaaaacgggctatcga
atggagaggcctgaaaactgcagtgaagaaatgtacaatctgatgttgcactgctggaag
caggaaccagataagaggccaacatttggggagatcagcaaagacctagagaagatgatg
gtgaagagtagggactacttggatcttgcagcttctaccccatctgactccttactttat
gatgatggcctttcagaagaggagactcccctcgtggactgtaataatgctcccctccct
cgaaccctcccttccacatggattgaaaacaaactctatggcatgtcatacccgaactgg
cctgaggagagtcctgtcccactcacaagattcgatggcactaactctgtgttttcaaga
tatgcaaatgatagtgtatatgctaactggatggtttcaccctcagcggcaaaattaatg
gacaagtttaatagttaa

DBGET integrated database retrieval system