KEGG   Sarcophilus harrisii (Tasmanian devil): 100927773Help
Entry
100927773         CDS       T02286                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03030  DNA replication
shr03410  Base excision repair
shr03420  Nucleotide excision repair
shr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100927773
   03410 Base excision repair
    100927773
   03420 Nucleotide excision repair
    100927773
   03430 Mismatch repair
    100927773
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:shr03032]
    100927773
   03400 DNA repair and recombination proteins [BR:shr03400]
    100927773
Enzymes [BR:shr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     100927773
    6.5.1.6  DNA ligase (ATP or NAD+)
     100927773
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     100927773
DNA replication proteins [BR:shr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    100927773
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     100927773
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     100927773
   NER (nucleotide excision repair)
    Other NER factors
     100927773
   MMR (mismatch excision repair)
    Other MMR factors
     100927773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR mRNA_cap_enzyme PucR Glyco_hydro_92
Motif
Other DBs
NCBI-GeneID: 100927773
NCBI-ProteinID: XP_023356771
Ensembl: ENSSHAG00000006383
LinkDB All DBs
Position
3
AA seq 952 aa AA seqDB search
MQRSIKSFFQPMSGDKVKKQEEPPKSSREREPASKAALKERNGVESESESPVKRVVRRAP
RVLGSEGEEDDEEPEEAARAAPREEEPSRPSPASCSRSPSDSSPSSVSPAGIPKRRTARK
QVPKRKLQELPEDPEGSEPKRHKGEGGKSAGRSPEQPPPVPEAEGEEQPPREASEEAAEE
AREGEVPARVPEGPTQAPEEPAQAPVQAPKASAGARTKTPKASAKASAKVPKAHTKAPAP
APEAPPETPTKAPSAAPKPFSSFFAPRKPAATKQAPPEAEAGKAAAEALGTPLDPAAYNP
SKSGYHPVDDACWKPGQRVPYLAVARTFEKIEEVSARLRMVEMLSNLLRSVVALSPADLL
PVLYLSLNQLGPPQQGLELGVGDGVLLKAVAQATGRQLDTIRAEMAERGDVGLVVEASRS
TQRTMLPLPHLTAAGVLSKLRDIARLTGSAATSKKIEIIKGLFVACRHSEARFIARALSG
RLRLGLAEQSVLAALAQAVSLTPPGQEFPPAVVDAGKGKAAEARKSWLEEKGLILKQTFC
EVPDLDLIIPALLKHGLDQLPQHCQLTPGVPLKPMLAHPTRGIGEVLKRFEESAFTCEYK
YDGQRAQIHVLDNGDVKIFSRNQEDNTGRYPDVISRVPKMKRPSVVSCILDSEAVAWDRA
KKQIQPFQVLSTRKRKEVDESDIQVQVCLYAFDLIYLNGQSLVREPLSRRRQLLRENFIE
TEGEFVFATSLDTEDTEQIADFLEQSVKDSCEGLMVKTLETNATYEIAKRSHNWLKLKKD
YLEGVGDTLDLVVIGAYLGRGKRAGRYGGFLLAAFDEDSEEFQAICKLGTGFSDEELEEH
YQNLQALVIPAPRSYVRAEGAVPPDHWLEPTTVWEVKCADLSVSPIYSAARGLVESDKGI
SLRFPRFVQVRKDKKPEEATSSAQVACLYMKQQQIQNQQDLETSDFDPEEFY
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgatccatcaagtcgtttttccagcctatgagcggtgacaaagtgaagaagcag
gaggagccccccaaaagcagcagggaaagagagccagcctccaaggctgctctgaaggag
aggaatggcgtggagtcggagagcgagtcaccagtgaagcgggtggtgaggagggcgccc
cgagtcctgggcagcgaaggcgaggaggacgacgaggagcccgaggaggcggctcgggcg
gccccccgagaagaggagcccagcagaccctccccggccagctgcagccgctccccctca
gactcgtcccccagcagcgtctctccggcggggatccccaagcgccgcacagctcggaaa
caggtgccgaagcggaagctgcaggagctgcctgaggacccggagggcagtgagcccaag
aggcataagggggagggaggtaagagtgcgggaaggagcccagagcagccccctccagtc
cctgaggctgagggggaggagcagcctcccagagaggcctcggaggaggccgctgaagag
gcaagggaaggagaggtgcccgcccgggtacccgaggggcccacgcaggcgcccgaagag
cctgcccaggcccctgtccaggcacccaaggcatccgccggggcacgcaccaagacaccc
aaggcttccgccaaggcttccgccaaggtgcccaaagctcacaccaaggcacctgcgcca
gcacctgaggcaccccccgagacccccaccaaggcgcccagcgcagcccccaagcccttc
agcagcttttttgccccccgaaaaccagcagcaacaaagcaggccccgccagaggctgag
gcggggaaggccgcagcagaggcgttgggcacgcccctagacccagctgcctacaaccca
tctaagagtggctatcaccccgtcgatgatgcctgctggaagccagggcagagggtcccc
tacctcgctgtggcacgaacctttgagaaaatcgaggaagtctccgctcggctccggatg
gtggagatgctgagcaacctcctgcgctctgtggttgccctgtcccccgccgaccttctc
cccgtcctctacctgagtctgaaccagctgggccccccccagcagggcctggagctcggt
gtgggggatggcgtcctcctcaaggcggtggctcaagccacagggcggcagctagacacc
atccgggctgagatggcagaacggggggacgtggggctggtggtggaggccagccgcagc
acccagcgcaccatgctgccactgccccatctgacggccgctggcgtgctgagcaagctc
cgggacatcgcccgcctcacgggcagtgctgccacatcaaagaagattgaaatcatcaaa
ggcttgtttgtggcctgccgccactcggaggcccgcttcatcgccagggctctgagcggg
cggctgcgcctgggactcgccgagcagtcggtgctggctgcgctcgcccaggccgtgagc
ctcacgccccccggccaagagttcccccccgccgtggtggatgctgggaagggcaaggcg
gcagaagccagaaagtcttggctcgaggagaaaggactgatcctgaagcagaccttctgc
gaggtgcccgacttggacctgatcatccctgccctgctcaagcacggcctggaccagctg
ccccagcactgccagctgaccccaggggtgcccctgaagcccatgctggcccaccccacc
cggggcatcggggaggtgctgaagcgcttcgaggagtcggccttcacatgtgaatacaag
tatgacgggcagagagcacagatccacgtcctggacaacggggacgtgaagatatttagc
cgcaaccaggaggacaacacgggccgatacccggacgtcatcagccgcgtccccaagatg
aagcgtccctccgtcgtctcctgcatcctggactcggaggccgtggcctgggatcgggca
aagaagcagattcagcccttccaggtgctcagcacccgaaagcgcaaggaagtagacgag
tcagacatccaggtccaagtatgtctgtatgcctttgacctcatctacctcaacgggcag
tccctggtgcgggagccgctgtcccggaggcggcagctgctccgggagaacttcatcgaa
acggagggtgagttcgtttttgccacgtctctggacacggaggatacggagcagatcgcc
gacttcctggagcagtcagtgaaagattcctgcgagggcctcatggtcaagacccttgaa
accaacgccacctatgagattgccaagaggtcccacaactggctcaagttgaagaaggac
tatctggaaggcgttggtgacaccctggacctggtggtgattggggcctatctgggccgg
ggaaagcgggccgggcgctacgggggcttcctgctggcggcctttgacgaggacagtgaa
gaattccaggccatctgcaagctgggcactggcttcagtgacgaagaattggaggaacat
tatcaaaacctccaggcgctcgtgattcctgctcctcgttcctatgtccgggctgaaggg
gccgtaccccctgaccactggctggagccgaccactgtgtgggaggtcaaatgtgctgat
ctctcagtctccccgatctattcagcagcccgaggattggtggagagcgacaagggcatc
tccctgcgcttcccccgatttgtccaagttcgaaaagacaagaagcccgaagaggcaact
tccagtgcccaggtggcctgcctgtacatgaaacagcaacagatccagaaccagcaggac
ttggagacctcggactttgatcctgaagagttctattag

DBGET integrated database retrieval system