KEGG   Sarcophilus harrisii (Tasmanian devil): 100927789
Entry
100927789         CDS       T02286                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00220  Arginine biosynthesis
shr00330  Arginine and proline metabolism
shr01100  Metabolic pathways
shr04020  Calcium signaling pathway
shr04066  HIF-1 signaling pathway
shr04146  Peroxisome
shr04371  Apelin signaling pathway
shr04926  Relaxin signaling pathway
shr05010  Alzheimer disease
shr05014  Amyotrophic lateral sclerosis
shr05022  Pathways of neurodegeneration - multiple diseases
shr05133  Pertussis
shr05140  Leishmaniasis
shr05142  Chagas disease
shr05145  Toxoplasmosis
shr05146  Amoebiasis
shr05152  Tuberculosis
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100927789 (NOS2)
   00330 Arginine and proline metabolism
    100927789 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100927789 (NOS2)
   04066 HIF-1 signaling pathway
    100927789 (NOS2)
   04020 Calcium signaling pathway
    100927789 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100927789 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100927789 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100927789 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100927789 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100927789 (NOS2)
   05014 Amyotrophic lateral sclerosis
    100927789 (NOS2)
   05022 Pathways of neurodegeneration - multiple diseases
    100927789 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100927789 (NOS2)
   05152 Tuberculosis
    100927789 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100927789 (NOS2)
   05145 Toxoplasmosis
    100927789 (NOS2)
   05140 Leishmaniasis
    100927789 (NOS2)
   05142 Chagas disease
    100927789 (NOS2)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100927789 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 100927789
NCBI-ProteinID: XP_012405248
Ensembl: ENSSHAG00000008893
LinkDB
Position
4
AA seq 1153 aa
MREGVSSACAMPRMCLLIKRIFGSHPMCCANGSSSQTEDDVKSHSLSKPRNEQQQTTLVE
EKKPPEPQVKGIHPVSGCPRHVRVKNWSNGMTFQDTLHHKAKLDIDCKSKACRGSIMTPK
SMTKGTRDRATSPEELLPQAIDFVNQYYGSFKEAKIEQHLARVEAVTKEIETTGTYQLTE
DELIYATKQAWRNAPRCIGRIQWSNLQVFDARKCTTAKEMFEHICQHIRYATNNGNIRSA
ITLFPQRSDGKHDFRVWNAQLLRYAGYQMPDGSIVGDAASTEFTQLCIDLGWVPKYGRFD
ILPLVLQANGQDPEVFEIPKDLVLEVSIEHPKYEWFKELDLKWYALPAVANMLLEVGGLE
FPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDRAVIEINVAVL
HSFQKQNVTIMDHHSAAESFMKYMQNEFKSRGGCPADWVWLVPPISGSITPVFHQEMLNY
VLSPFYYYQVEAWKTHVWHDEKKRPKKREIKLKVLIKAVFFASVLMRKTVAARINVTVLF
ATETGKSETLARDLGDLFSCAFNSKVLCMDEYKLSDLEKEKLLLVVTSTFGNGDSPGNGE
KLKKSLFLLKELKNKFRYAVFGLGSSMYPQFCAFAHDIDEKFLQLGASQLAPTGEGDELS
GQDEAYRSWALNTFKVACETFSIQGRETIQIPKLYTTNETWNPENYRLVQDPQPLDLNKA
LSSMHAKNVFSMRLKSRQNLQSLKSSRATLLIKLSCEGNQNLNYIPGEHLGVFPGNQPTL
VQGILERVKDGPSPHQSVRLETRDENGDYWISDKKLPPCSLSQALTYFLDITTPPTQLLL
RKLAQLTTSEEEKRRLEALCQTSEYNKWKFTNVPTFLEVLEEFPSIQISATFLLTQLPLL
KPRYYSISSSRDLTPKEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNNLKLQETVPCFVRS
ASGFQLPENPSHPCILVGPGTGIAPFRSFWLQRLADREKKGLKNPNMTLVFGCRHPDMDH
LYREEMKEMTQKGVLRDVYTAYSRQPGQPKVYVQDILRQRLADEVIRTLHEEKGHLYVCG
DVRMARDVAQTLKDLFATRLKMNEEQTENYFFQLKSQKRYHEDIFGAVFPYEVKTDQAAS
KPEETKLSKAGLS
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgagggaaggggtcagctctgcctgtgccatgccaaggatgtgcctgctgattaaaagg
atctttgggagtcatcctatgtgctgtgcaaatggatccagttcacagacagaggatgat
gttaagtctcacagcctgagtaaacctcggaatgagcagcaacaaacaactttggtggag
gaaaagaagcctcctgaaccccaggtcaaggggatccatcccgtatcaggctgtccaagg
cacgtgagagttaaaaactggagtaatggaatgacattccaagacactctacatcacaaa
gccaaactggatattgattgcaagtccaaggcttgtcgagggtcaataatgacccccaag
agtatgacaaaagggactagagacagagcgacctctccagaagagctgctacctcaagcc
atcgactttgtcaaccagtattacggctccttcaaagaggcaaaaatagagcagcatttg
gccagagtggaagcagtaacaaaggagatagaaacaacaggaacctaccagctgacggaa
gatgagctcatttatgcaaccaagcaggcctggagaaatgcccctcggtgcattggaagg
atccagtggtcaaacctgcaggtgtttgatgctcggaaatgtacaacagccaaggagatg
tttgagcacatctgtcagcacatccgctatgcaaccaacaatggaaatatcaggtcagcc
attaccctcttccctcagcggagtgatgggaaacatgacttccgggtctggaatgctcag
ctccttcgatatgctggctatcagatgccagatggttctatcgtgggtgatgctgccagc
accgagttcacccagctgtgtatagacttgggatgggtgcccaaatacggccgctttgat
atcttgcctctcgtgttacaagccaatggacaggacccagaggtctttgagatcccaaaa
gaccttgtcctcgaggtgtctatagaacatcccaagtatgagtggttcaaggagctggat
ctgaagtggtatgctctgcctgctgtggccaacatgctcctggaagtgggcggccttgag
ttccctgggtgcccattcaatggctggtacatgggaactgagattggtgtccgagatttc
tgtgatgtccagaggtacaatatcctggaggaagttggaaggaggatgggtctggaaacg
cataaattggcttccctctggaaggacagggcagtgattgagatcaacgtggccgtgctg
catagtttccaaaaacaaaatgtcaccatcatggatcaccattcagctgcagaatctttc
atgaaatatatgcagaatgaattcaagtctcgaggcggttgcccggcagattgggtctgg
ctggtccctccaatctctgggagcatcactcctgtgtttcatcaggagatgctaaactac
gttctttctcctttctactactaccaggtggaggcctggaaaacccatgtctggcatgat
gagaagaagaggcccaaaaaaagagagatcaaattaaaggtcttgatcaaagcagtgttc
tttgcctctgtcctgatgcgcaagactgtggcagctcggatcaacgtcactgtgcttttt
gcgacagagacaggcaaatcagaaactctggccagggatttgggagacttgttcagctgt
gctttcaatagcaaggttctctgtatggatgaatacaaactgagtgatctagaaaaagag
aagctacttctggtggttaccagcacttttggaaatggagattctcctgggaatggtgag
aaactgaagaagtccctgtttctcctgaaggagctaaaaaataaattcagatatgctgtg
tttggtctcggctccagtatgtatccccagttttgtgcctttgcccatgatatcgatgag
aagtttttgcaattgggggcctctcaacttgcaccaactggagaaggagatgaactcagt
ggacaagatgaagcctaccgtagctgggcactgaataccttcaaggtggcctgtgagacc
ttcagcatccaaggaagggaaacaattcagatccccaagttatatactaccaatgaaacc
tggaaccctgaaaattaccgtcttgtacaggatccccaacctctggacctcaacaaagcc
ctcagcagtatgcacgccaagaacgtgttttccatgcggctcaaatcgagacagaatctg
cagagtctcaaatccagccgggcaaccctcctcattaaactttcctgtgaaggaaaccag
aatctgaattatataccaggagagcatcttggggtttttcctggaaaccagcccacccta
gttcagggtattttagaacgagttaaggatggcccatcacctcaccaatctgtgcgctta
gaaacccgtgatgagaatggtgactactggataagtgataagaagcttcccccctgctcg
ctcagccaagccctaacttatttcctggatatcaccacccctccaacccagctgctgctc
agaaagttggctcagctgaccacctcagaggaagagaagagacgtctggaggcactgtgc
cagacctctgaatacaataagtggaagttcacaaacgtccccacgttcctggaggtgctg
gaagagtttccttccatccagatctcagcgactttcctgctcacacagttgcccctgctg
aagccccgctactattccataagctcctctcgggacctcacccccaaggagatccacctg
actgtggctgtggtcacttaccataccagagacggtcagggccctctccatcatggggtc
tgtagcacatggctcaacaacctgaagctccaggaaaccgtgccctgttttgtacgaagt
gccagtggcttccagctcccagagaatcccagtcacccctgcattctggtgggaccgggc
accggtatcgcccccttcaggagtttttggctacagcgactggcggacagagagaagaaa
ggtctcaagaaccccaatatgacgttggtgtttggatgccggcaccccgacatggaccac
ctgtatcgagaggagatgaaggagatgacacagaaaggagtgctccgggatgtctacaca
gcctactcccgccagcccggccagcccaaagtctatgttcaggatattctgcggcagcga
ctggcagatgaggtgattcggacattgcatgaggagaaggggcacctgtatgtctgtgga
gatgtgaggatggccagagatgtggcccaaactctgaaggatctctttgccaccagactg
aaaatgaatgaagagcagactgagaactatttcttccaactcaagagtcagaagcgttac
cacgaagacatctttggggctgtctttccctatgaggtgaaaactgaccaagcagcatca
aaacctgaagagaccaagctctctaaggcaggactcagctag

DBGET integrated database retrieval system