KEGG   Sarcophilus harrisii (Tasmanian devil): 100928055
Entry
100928055         CDS       T02286                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B isoform X1
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04012  ErbB signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04110  Cell cycle
shr04151  PI3K-Akt signaling pathway
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04934  Cushing syndrome
shr05162  Measles
shr05165  Human papillomavirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05203  Viral carcinogenesis
shr05206  MicroRNAs in cancer
shr05215  Prostate cancer
shr05220  Chronic myeloid leukemia
shr05222  Small cell lung cancer
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100928055 (CDKN1B)
   04066 HIF-1 signaling pathway
    100928055 (CDKN1B)
   04068 FoxO signaling pathway
    100928055 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    100928055 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100928055 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100928055 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    100928055 (CDKN1B)
   05206 MicroRNAs in cancer
    100928055 (CDKN1B)
   05203 Viral carcinogenesis
    100928055 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    100928055 (CDKN1B)
   05220 Chronic myeloid leukemia
    100928055 (CDKN1B)
   05215 Prostate cancer
    100928055 (CDKN1B)
   05222 Small cell lung cancer
    100928055 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100928055 (CDKN1B)
   04934 Cushing syndrome
    100928055 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    100928055 (CDKN1B)
   05169 Epstein-Barr virus infection
    100928055 (CDKN1B)
   05165 Human papillomavirus infection
    100928055 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100928055 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100928055
NCBI-ProteinID: XP_003771318
Ensembl: ENSSHAG00000011524
UniProt: G3WDH8
LinkDB
Position
5
AA seq 199 aa
MSNVRISDGSPTLERMEGRPAEYPKPSACRNLFGPVNHEDLTQDLKKHCRDIEEDCQRKW
NFDFRNHKPLEGNYEWQPVEKDSLPEFYFRPPRNPKGRCQGPGQQSGDLNGVRQTGFFIA
SQGISEDTHLRDQKTEGASESQTSLADQCTETRKRPATDDVSPQNKRANITEEEVTDTSP
NASSVEQTPKKPSLRRHQT
NT seq 600 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgtatttctgacgggagcccgaccctggagcggatggaaggcaggccg
gctgagtaccccaagccttcagcttgccgcaacctcttcggcccagtaaaccatgaagat
ttaacgcaggacttaaagaagcattgcagggatatcgaggaggactgtcagcgcaagtgg
aacttcgactttcggaatcacaagcccttggaggggaattatgagtggcaacctgtggag
aaagatagtttgcccgagttttatttcaggcccccgcggaaccccaaggggagatgccag
gggcccggccagcagagcggggatctaaacggagtgcgccaaacggggttttttattgct
tctcagggaatctcagaggacacccacttaagagatcaaaagactgagggtgcatccgaa
agccagacgagtttggcagaccagtgcactgagacgaggaaacgaccagccacggatgat
gtctcacctcaaaacaaaagagccaacattactgaagaagaggttacagacacttctccc
aatgctagttcagtggagcagacgcccaagaagcccagtctcagaagacatcaaacgtaa

DBGET integrated database retrieval system