KEGG   Sarcophilus harrisii (Tasmanian devil): 100928371
Entry
100928371         CDS       T02286                                 

Gene name
ZBTB17
Definition
(RefSeq) zinc finger and BTB domain-containing protein 17 isoform X1
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04110  Cell cycle
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100928371 (ZBTB17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100928371 (ZBTB17)
   05202 Transcriptional misregulation in cancer
    100928371 (ZBTB17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100928371 (ZBTB17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100928371 (ZBTB17)
   04121 Ubiquitin system [BR:shr04121]
    100928371 (ZBTB17)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    100928371 (ZBTB17)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     100928371 (ZBTB17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-met zf-C2H2_6 zf-H2C2_5 zf-C2HC_2 Zn-ribbon_8 zf-BED zf-Di19 zinc_ribbon_15 zf-C2HE zf_UBZ HypA XPA_N zf-C2H2_2
Other DBs
NCBI-GeneID: 100928371
NCBI-ProteinID: XP_031818651
LinkDB
Position
3
AA seq 810 aa
MAAMDFPQHSQLVLEQLNQQRQLGLLCDCTFVVDGINFKAHKAVLAACSEYFKMLFVDQK
DVVHLDISNAAGLGQVLEFMYTAKLSLSPENVEDVLAVAGFLQMQDIVSACNALKSLPGS
ASSASEKLEPAEPDGEEKKAEEEKKAAAAALSELDRARLGGERNGEPEAQAQSGGDGLGA
ESEKEAEGQEPAPAETGPSPVGTPLEVLLSQRSLQEGEAESQRSDTVHPNDPAEMEAEPV
REDEEQEDKSPEGAALGETSPAEEGGPQLENGEPPEENEESGGTDSGQENAGEARVLRSG
TYSDRTESKAYGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECNKAFSDPAACK
AHEKTHSPLKPYGCEECGKSYRLISLLNLHKKRHTGEARYRCDDCGKLFTTSGNLKRHQL
VHSGEKPYQCDYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIA
DGPLKCRECGKQFTTSGNLKRHLRIHSGEKPYVCVHCQRQFADPGALQRHVRIHTGEKPC
QCLICGKAFTQASSLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSV
CSKAFVNVGDLSKHIIIHTGEKPFLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKIVEPDE
GDEVNIVTVASDDMVTLATEALAATAVTQLTVVPVGAAVTADETEALKAEITKAVKQVQE
ADPNTQILYACDSCGEKFLDANSLAQHVRIHTAQALVMFQADTDFYQQYGPGSTWQAEQV
LQAGELLFRPREGAEGQPALAEPPPPTVAE
NT seq 2433 nt   +upstreamnt  +downstreamnt
atggcagccatggatttcccgcaacatagccagctggtcctggagcagttgaatcagcag
cggcagctgggcctgctgtgtgactgcacctttgtggtggacggaatcaactttaaggcc
cacaaggccgtgctggcggcttgcagtgagtacttcaagatgctctttgtggaccaaaag
gacgtggtgcacctggacatcagtaacgcggcaggtctgggccaggtgctggaattcatg
tacacggccaagctgagcctgagccctgagaacgtggaggacgtgctagctgtggcaggc
ttcctccagatgcaggacattgtcagtgcctgcaatgccctcaagtctcttcccgggtcc
gcttccagtgcctcggagaagctagaaccggcagagcccgacggggaggaaaagaaggcc
gaagaggagaagaaggccgcggccgccgccctcagcgagctggaccgagcacgactcggc
ggggaaaggaacggcgagccggaggcccaggcccagagcggcggggatgggctcggtgca
gagagcgagaaggaagcggagggccaggagccggcgcctgcagagaccggacccagccct
gtgggtacacctcttgaggtactcctgtcacagagatcactgcaagagggggaagctgag
agccagagaagtgacaccgttcacccaaatgacccagcagaaatggaggctgagccagtg
agggaggatgaggaacaggaagacaagagcccagaaggagcagccctaggggagacgagt
ccggccgaggagggcgggccgcagctcgagaacggagagccccccgaggagaacgaagag
tctggaggcacagattctgggcaggagaacgcgggggaggctcgggtcttacgctcgggc
acctacagcgaccgcacggagtcgaaggcctacggctcagttattcacaagtgtgaggat
tgtgggaaggagttcactcacacgggaaacttcaagcggcacatccgcatccacactgga
gagaagcccttctcgtgccgggagtgtaacaaggccttctctgaccctgcggcttgcaag
gcccacgagaaaacacacagccccctgaagccctatggctgtgaggagtgcggcaagagc
taccgactcatcagcctgctcaacctgcacaagaagcgccacacgggggaggcccgctac
cgctgcgacgactgtggcaagctcttcaccacctcgggcaacctgaagcgccaccagctg
gtgcacagcggggagaagccctaccagtgtgactactgcgggcgctccttctccgacccc
acctccaagatgcgccacctggagacccacgacaccgacaaggagcacaagtgcccgcac
tgcgacaagaagttcaaccaggtgggcaacctgaaagcgcatctaaagatccacattgct
gacggacccctgaagtgcagggagtgcggcaagcagtttaccacctcaggaaacctgaag
cggcaccttcgcatccacagtggggagaagccttatgtctgcgtccattgtcagaggcag
tttgcagacccaggtgccctgcagaggcacgtgcgcatccacacgggagagaagccgtgc
cagtgcctcatctgcgggaaggctttcactcaggccagctccctcattgcccacgtgcgc
cagcacactggtgagaagccctacgtctgtgagcgctgcggcaaaaggtttgtccagtct
agccagctggccaaccacatccgccaccatgacaacatccgcccgcacaagtgcagcgtg
tgcagcaaggcctttgtcaatgtgggggatctctccaagcacatcatcatccacacgggg
gaaaagcccttcctctgtgacaagtgtggacgcggcttcaatcgtgtggacaaccttcgc
tcccacgtgaagacggttcaccagggcaaggcgggcatcaagatcgtggagccggacgag
ggggacgaggtcaatatcgtcaccgtggcctcggatgacatggtcaccctggccacggag
gccctggccgccacggccgtcacccagctcacagtggtgcctgttggggccgcagtgacg
gcggatgagacggaagccctgaaagctgagatcaccaaagccgtgaagcaggtgcaggaa
gcagacccaaacacccagatcctctatgcctgcgactcgtgcggtgagaagttcctggac
gccaacagcttggcccagcacgtccggatccacacggcccaggccctggtcatgttccaa
gcggacacggacttctaccagcagtacgggccgggcagcacgtggcaggcggagcaggtg
ttgcaggccggggaactgcttttccgccccagggaaggggctgagggccagcccgccctg
gcagagccccctccacccactgtggctgaatga

DBGET integrated database retrieval system