KEGG   Sarcophilus harrisii (Tasmanian devil): 100928379
Entry
100928379         CDS       T02286                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3 isoform X1
  KO
K06482  integrin alpha 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr04640  Hematopoietic cell lineage
shr04810  Regulation of actin cytoskeleton
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
shr05410  Hypertrophic cardiomyopathy
shr05412  Arrhythmogenic right ventricular cardiomyopathy
shr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100928379 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100928379 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100928379 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100928379 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100928379 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100928379 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100928379 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100928379 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100928379 (ITGA3)
   05414 Dilated cardiomyopathy
    100928379 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100928379 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100928379 (ITGA3)
   04515 Cell adhesion molecules [BR:shr04515]
    100928379 (ITGA3)
   04090 CD molecules [BR:shr04090]
    100928379 (ITGA3)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100928379 (ITGA3)
Cell adhesion molecules [BR:shr04515]
 Integrins
  Integrin alpha subunits
   100928379 (ITGA3)
CD molecules [BR:shr04090]
 Proteins
  100928379 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS MLANA
Other DBs
NCBI-GeneID: 100928379
NCBI-ProteinID: XP_031821925
Ensembl: ENSSHAG00000012691
LinkDB
Position
4
AA seq 1066 aa
MDPGPGGRGVPCVQRLPLCTLALALVAVGCNVASAFNLDTRFLVVKEASNPGSLFGYSVA
LHRQTEQQRRYLLLAGAPQDLALHDSQTNRTGAVYLCPLSDRTDDCERMNIVEKSDPRQH
IIENMWLGVTVASQGPAGRVLVCAHRYTKVLWSGSEDQRRMVGKCYVRGNDLQLDPRDDW
QTYHNEMCNSNTDYLGTGMCQMGTSGGFTHNTVYFGAPGAYNWKGTTYMIQRKDWDFSEH
SFTDKEDVGHLYIGYTVQVGNGVLHPESLTIVAGAPRDRHSGSVFLMNLEAGGEMQLKQV
LEGKQVGAYFGSAIALADLNNDGWQDILVGAPYYFERKEEIGGAIYIFMNQGGIFPTSPS
QHLYGPSGSTFGFSVASLGDINQDGFQDVAVGAPFEGSGKVYIYHSSASGLKDQPQQVIH
GDKLGTHGLATFGYSLSGRLDVDENSYPDLLVGSLADRIVLLRARPVINILNKTLAVRPT
MLDPARCTSTSCIQVEVCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRVRFAKSLSST
YHGLFSMPETHCQTLDLLLVDNIRDKLRPISIFMNYSLPEKLPKHPRLGLHSLDAFPILN
EAQPRENQTEIQFQKECGTDNKCDSNLQLQAAFLSEQLQPINRLQYSKEVRKLFLNINVT
NMPSRDRAGEDAHEALLTLVLPPALLFSSVRPAGACQANETILCELGNPFKRNQKMELFI
AFEVIGITLQTRDIEAQMQLSTSSHQDNLKPVTLMLQVDYTLQASLGMVNHRLQSYFGGT
VMGESGMKNVTDVGSPITLEFQVGPVDEGLTSLGTLVLGLEWPYEVSNGKWLLYPTEIII
QGNGTWHCQPPGDLINPLNLTISKDEASSQRRRRRELDPGESQAPPPITLATSRKAESET
VLSCANGRARCVWLECPIPDVSVPSTMTVQARVWNSTFIEDYSDFDRVRVDGWATLFLQT
NILTINMENKTTWFSVDIDSELTEEIPTEIELWLVLVSVGAGLLLLGLIILLLWKCDFFK
RTHYYRIMPKYHAVRIREEERYPPPGGTLPPKKHWVTNWQDRDRYY
NT seq 3201 nt   +upstreamnt  +downstreamnt
atggacccgggccccggcggccgcggtgtcccctgtgtccagcgtctgcccctctgcacc
ttggcgctggccctggtcgctgtcggctgtaatgtagcctccgccttcaacctggacacc
cggttcctagtggtgaaggaggcctcgaaccctgggagcctcttcggctactcggtcgcc
ctccatcggcagactgagcagcagcggcgctacctactccttgctggtgctccccaggat
cttgctttacatgacagccaaaccaaccggacaggtgcagtgtacctgtgccccctcagt
gaccgaacagatgactgcgaacggatgaacatagtggaaaaaagtgatcccaggcagcac
attattgagaacatgtggcttggggtgacggtggccagccagggacctgctggcagagtg
ttggtctgtgcccatcgctacaccaaggtgctgtggtcaggatcagaggaccagcggcgg
atggtgggcaagtgttacgtgcggggcaatgatctacagctcgaccccagagatgactgg
cagacgtaccacaatgagatgtgcaacagcaacacagactatctgggcacaggcatgtgc
cagatgggtaccagcgggggctttacccacaacactgtgtactttggggcacctggtgcc
tacaactggaaaggtaccacctacatgatccagcgaaaagactgggatttttcagagcac
agttttacagacaaagaggatgtaggacatctctacatagggtacacagtacaggtgggg
aatggggtcttgcaccctgagagtctcaccattgtagctggtgctccccgggaccgccat
tcaggctctgtcttcctcatgaacctggaggcaggtggggaaatgcagctgaaacaagtg
ttagaggggaaacaggtgggcgcctacttcggcagtgccatcgctctagcagaccttaac
aatgatgggtggcaggatatcctggtgggtgccccctactactttgaacggaaggaagag
attggtggtgccatctacattttcatgaatcaaggaggcatcttccccactagcccttct
caacacctctatggcccaagtggctcaacttttggcttctctgtggccagccttggggac
atcaaccaggacggcttccaggatgttgcagtgggtgctccatttgagggttctggcaaa
gtctacatctaccacagcagtgcctcaggcctcaaggaccaacctcaacaggtgattcat
ggggataagcttggcacccatggcctggccacctttggctactcgctgagtgggcggctc
gacgtggatgagaactcgtaccccgacctgctggtggggagcctggctgaccgcatcgtg
ctgttgcgagcccgtccagttatcaacattctcaacaagactctggcagtgaggccgacc
atgctggatcctgcccgctgtacttccacctcgtgcattcaggtcgaggtatgcttcgcc
tacaaccaaagtgcagggaatccaaactacagacgaaacatcaccctggcatataccctg
gaggcagatcgagatagacgcccaccccgagtccggtttgctaagagtctttcttctacc
taccatggactgttttccatgcctgaaacacactgccaaacccttgatctgcttctggtg
gacaatattcgggacaagctccgccccatctccatcttcatgaactactctttaccagaa
aagcttcctaagcacccacgccttggactccattccctggatgcctttcctatccttaat
gaggcccagcccagagagaaccaaacagagattcagttccagaaggaatgtggtactgac
aataagtgtgatagtaacttacagcttcaggctgctttcttgtctgaacagctacagccc
atcaatagacttcagtacagtaaggaggtccgaaagctgttcctgaacatcaatgtaacc
aacatgcccagcagggaccgagctggagaagatgctcatgaggctttgctcaccttagtt
ttgcctccagccttacttttctcctctgtccgccctgctggagcttgccaggctaatgag
accatcctatgtgagctgggaaacccttttaaaaggaaccagaagatggagctgtttatt
gcctttgaggtcattggtatcaccctacagactcgggatattgaggctcagatgcagctt
tccacgtctagtcaccaggataacctaaagcctgtgactttgatgctgcaggtggattat
acactccaggcctctcttggcatggtgaatcaccgactacagagttactttggaggaaca
gtgatgggagagtcaggcatgaaaaatgtcactgatgtggggagccctatcaccttggaa
ttccaggtgggcccagtggatgagggactgacatctttgggaactctggtcttagggctg
gaatggccctatgaagttagtaatggcaagtggcttctgtatcccaccgagattatcatc
cagggcaatggaacctggcattgccagccacctggggacctcatcaatcctctcaacctc
acaatttctaaggatgaagcctcttcccagagacgccggcgaagggagctggatcctgga
gaatcacaggcacctcctcctatcaccctggccacttccaggaaggcagagtcagagact
gtgttgtcatgtgccaatggtcgagctcgctgtgtgtggctggagtgcccgattcctgat
gtctcagtgccctccaccatgacagtgcaggcacgagtgtggaatagcaccttcatcgag
gattacagtgattttgacagagtcagggtggatggctgggctacccttttcctccaaacc
aacatcctgactatcaatatggagaataagacaacatggttttctgtggacattgactca
gaactgacagaggagattcctacagagattgagctctggctggtcctggtgtctgtggga
gctgggctgttactgttggggctcatcatccttttgctttggaagtgtgacttcttcaaa
cggacccattattaccggatcatgccaaagtaccatgctgtgcggatacgggaggaggag
aggtacccacccccagggggcacactgccccccaagaagcactgggtcaccaactggcag
gatcgggaccgatactactga

KEGG   Sarcophilus harrisii (Tasmanian devil): 100929053
Entry
100929053         CDS       T02286                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V
  KO
K06487  integrin alpha V
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04145  Phagosome
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr04514  Cell adhesion molecules
shr04810  Regulation of actin cytoskeleton
shr04919  Thyroid hormone signaling pathway
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05222  Small cell lung cancer
shr05410  Hypertrophic cardiomyopathy
shr05412  Arrhythmogenic right ventricular cardiomyopathy
shr05414  Dilated cardiomyopathy
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100929053 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100929053 (ITGAV)
   04514 Cell adhesion molecules
    100929053 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100929053 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100929053 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100929053 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100929053 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100929053 (ITGAV)
   05205 Proteoglycans in cancer
    100929053 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100929053 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100929053 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    100929053 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100929053 (ITGAV)
   05414 Dilated cardiomyopathy
    100929053 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100929053 (ITGAV)
   05165 Human papillomavirus infection
    100929053 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100929053 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100929053 (ITGAV)
   04515 Cell adhesion molecules [BR:shr04515]
    100929053 (ITGAV)
   04090 CD molecules [BR:shr04090]
    100929053 (ITGAV)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100929053 (ITGAV)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100929053 (ITGAV)
  Exosomal proteins of epithelial cells
   100929053 (ITGAV)
Cell adhesion molecules [BR:shr04515]
 Integrins
  Integrin alpha subunits
   100929053 (ITGAV)
CD molecules [BR:shr04090]
 Proteins
  100929053 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 100929053
NCBI-ProteinID: XP_031816209
Ensembl: ENSSHAG00000009021
LinkDB
Position
3
AA seq 1063 aa
MAPWLGRRRRRRLPLLLLHLRGGRFHLLLPGLLLLLLPPLPHLCSAFNLDVDSPAEYSGP
EGSYFGFAVDFFAPDPSSMFLLVGAPKANTTQPGIVEGGQVLKCSWSSNRMCKPVEFDST
GNRDYATNDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTELKQEREPVGTCFLQDGTK
TVEYAPCRSKNIDADGQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKY
DPHVYSIKYNNQLATRTAQAVFDDSYLGYSVAVGDFNDDGIEDFVSGVPRAARTLGMVYI
YDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQV
SMCLQQASGGFQIIKLNGFEIFARFGSAIAPLGDLDQDGFNDVAIAAPYGGEDKRGIVYI
YNGRATGLNSAPSQILEGQWAARAMPPSFGYSLKGATDIDQNGYPDLIVGAFGVDRAVLY
RARPVITVNAGLEVYPTILNQDNKTCPLPGTDVKVSCFNVRFCLKADGKGRLPEKLNFQV
ELLLDKLKQKGAIRRALFLHNKSPGHSKNMSILKGGQMQCEELTAYLRDESEFRDKLTPI
TIFMEYRLDYKTAADVTGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVHSDQK
KIYIGDDNPLTLIVNAQNLGEGAYEAELIVSIPPQADFIGGVRNSETLSRLSCAFKTENQ
TRQVVCDLGNPMKAGTKLLAGLRFSVHQQSEIDTSVKFDLQIQSSNLYDKMSPVVSYQVD
LAISAAVEIRGVSSPDHVFLPIPNWEHKENPQTEEDVGPAVQHIYELRNNGPSSFSKAIL
NLHWPYKYNNNTLLYILHYEVDGPMNCTSDMEINPLKIKISTPQIDDKNETNLGQGDRNH
HISRRDIPHNEADVHTLGCGTAECLKIVCHVGRLDRGKSVILYVKSLLWTETFMNKENQN
HSYSLKSSASFNVIEFPYKNLPIDDIHNSTLVTTNITWGIQPSPMPVPLWVIILAVLAGL
LLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGTSDA
NT seq 3192 nt   +upstreamnt  +downstreamnt
atggccccttggctgggtaggagacggcggcggcggctgccgctactgcttcttcacctc
cggggcggccgcttccacctccttctcccgggcctcctcctgctgctactgccgcccctg
ccacatctctgcagcgctttcaacctggatgtggatagtccggccgagtattccggtccg
gagggaagttacttcggctttgcggtggatttcttcgccccagatccttcctcgatgttc
cttcttgttggagctcctaaagcaaacactactcaaccaggcattgtagaaggaggacaa
gtgctcaagtgcagctggtcttctaatcgaatgtgcaagccagtggaatttgactcaaca
ggcaatagagattatgccacaaatgatccattggaatttaagtctcaccaatggtttgga
gcgtccgtgagatctaaacaggataaaattttggcctgtgcgccattatatcattggagg
actgaactgaaacaagagagagaacctgttggaacatgctttctacaagatggaacaaag
actgttgagtatgctccttgtcgatcaaaaaatattgatgctgatggacagggattttgt
caaggaggcttcagcattgattttacaaaagcagacagagtacttctgggaggtcctggc
agtttttattggcaaggtcaactcatttctgatcaagtggcagaaattgtgtctaaatat
gacccccatgtatatagcatcaaatataataatcagttagcaactcggacagctcaggct
gtttttgatgacagctacctaggctactctgtggctgttggagacttcaatgatgatggc
atagaagactttgtttctggagtcccaagagctgcaaggacattgggaatggtttatatt
tatgatggaaaaaatatgtcttctttgtataattttactggagaacagatggctgcatat
tttggattttctgtagctgctactgacattaatggggatgattatgcagatgtgtttatt
ggagcccctctcttcatggatcgtggatctgatggcaaacttcaggaagtgggtcaggtc
tccatgtgcctgcagcaagcttcaggaggatttcagatcattaagctgaatggctttgag
atatttgccagatttggcagtgctattgcccctctgggagatcttgaccaggatggcttc
aatgatgttgccattgctgccccttatgggggagaagacaaaagaggaattgtttatatc
tacaatggaagagccacaggcttaaattcagcaccatctcaaatccttgaaggacagtgg
gctgctcgggccatgccaccaagctttgggtactcattgaaaggagccacagatatagat
caaaatggatacccagatttaattgtaggtgcttttggtgtggaccgagctgttttatat
agagccaggccagttatcactgtaaatgcaggactagaagtttaccccactattctaaat
caagataataagacctgtccactccctggcacagatgtcaaagtttcctgttttaatgtg
agattctgcttaaaggctgatggcaaagggaggcttccggagaagctgaatttccaggtt
gaacttcttttagataaactgaagcaaaaaggagccattaggagagccctatttctccat
aacaaatcacccggacactcaaagaacatgagtattttaaaaggtggtcagatgcaatgt
gaggaacttacagcatatctacgggatgaatctgaatttagagataagcttactccaatt
actatttttatggaataccgattagattacaagacagcagctgatgtgactggattgcaa
cccattcttaatcagttcactcctgccaatattagtcgacaggctcacattttattggac
tgtggtgaagacaatgtctgtaaacccaaactggaagtttctgtacatagtgatcaaaag
aagatctatattggtgatgacaaccctctgacactgattgttaatgcccagaatttaggg
gaaggagcttatgaggctgagcttattgtgtccattcctccccaggcagatttcataggt
ggtgtccgtaacagtgagactttatcaaggctgtcctgtgcatttaagacagagaatcaa
acacggcaagtagtatgtgaccttggaaatcccatgaaagctggaactaaacttttagct
ggtcttcgtttcagtgtgcaccaacagtcagagatagatacttctgtgaagtttgattta
caaatccagagctctaatctgtatgataaaatgagtccagtggtatcttaccaagttgac
cttgccatttctgctgctgttgagataagaggagtctcaagccctgatcatgtctttctt
cctattccaaactgggagcataaggagaatccacagactgaagaggatgttgggcctgct
gtgcaacacatctatgagctgagaaacaatggtccaagttcattcagcaaggcgatacta
aatctccactggccttacaagtataacaacaatactttgctatatatccttcactatgaa
gttgatggaccaatgaactgtacttcagatatggagattaacccattaaaaattaagatt
tcaactcctcagatagatgacaaaaatgaaacaaatttaggacaaggtgaccgcaatcat
cacatcagtagacgggatataccgcacaatgaagcagatgtacacactttgggatgtgga
actgctgaatgtttgaagattgtctgccacgttggtcgccttgataggggaaagagtgtg
atcttgtatgtaaagtctctgttgtggactgagacattcatgaataaagaaaatcagaat
cattcatactccctgaagtcatcagcttcattcaacgtcatcgaattcccctataagaac
ctcccaattgatgacattcacaactctacattagttaccactaatattacctggggtatt
caaccatcacccatgccagtgcctttatgggtgatcattttagcagttctagctggatta
ttattattggctgttctagtctttgtaatgtacaggatgggtttttttaaacgggtcagg
ccacctcaagaagaacaggaaagagaacagcttcagcctcatgaaaatggtgaagggact
tcagatgcttaa

KEGG   Sarcophilus harrisii (Tasmanian devil): 100929219
Entry
100929219         CDS       T02286                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr04514  Cell adhesion molecules
shr04640  Hematopoietic cell lineage
shr04810  Regulation of actin cytoskeleton
shr05145  Toxoplasmosis
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
shr05410  Hypertrophic cardiomyopathy
shr05412  Arrhythmogenic right ventricular cardiomyopathy
shr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100929219 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100929219 (ITGA6)
   04514 Cell adhesion molecules
    100929219 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100929219 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100929219 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100929219 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100929219 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100929219 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100929219 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100929219 (ITGA6)
   05414 Dilated cardiomyopathy
    100929219 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100929219 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100929219 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100929219 (ITGA6)
   04515 Cell adhesion molecules [BR:shr04515]
    100929219 (ITGA6)
   04090 CD molecules [BR:shr04090]
    100929219 (ITGA6)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100929219 (ITGA6)
  Exosomal proteins of breast milk
   100929219 (ITGA6)
Cell adhesion molecules [BR:shr04515]
 Integrins
  Integrin alpha subunits
   100929219 (ITGA6)
CD molecules [BR:shr04090]
 Proteins
  100929219 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM DUF4381 Integrin_alpha
Other DBs
NCBI-GeneID: 100929219
NCBI-ProteinID: XP_003764005
Ensembl: ENSSHAG00000017311
LinkDB
Position
3
AA seq 1093 aa
MAASGQLELLFYLSACLLLRFCAAFNLDTREENVIRKIGDPESLFGFSLAMHWQLHPQDK
RLLLVGAPRAKAFPLQKANRTGGLYSCDITSQAPCQRIEFDNDADPYSESKEDQWMGVTV
QSQGPGGKVVTCAHRYERRQHVNTKQESRDIIGRCYVLSQSLTIEDDMDGGDWSFCDGRL
RGHEKFGSCQQGVSATFTKDFHYIVFGAPGTYNWKGIVRAEQKNNTFFDMNIFEDGPYEV
GGETDHDESLVPVPANSYLGFSLDSGKSIISKDEITFVSGAPRANHSGAVVLLKRDMKSA
HLFTEHLFEGEGLASSFGYDVAVVDLNKDGWQDIVVGAPQYFDRDGEVGGAVYVYINQQG
KWNNVKPIRLNGTKDSMFGIAVENIGDINQDGYPDIAVGAPYDDFGKVFIYHGSPSGINT
KPTQVLEGKSRYFGYSIAGNMDLDRNSYPDVAVGSLSDSVSIFRSRPVINIQKTITVTPN
RIDLRHKMACDAPSGICLKVKACFEYTAKPSSYNPAISIVGTLEAESQRRKSGLSSRVHF
PNQASEPKSSHELTLKGQKQKMCMERILWLQDNIRDKLRPIPITASVEIKEPNSRRRVNS
LPELLPILNSNEPKTVTSEVQFLKEGCGDDNICNSNLKLEYRFCTRDGNQDKFSYLPIHN
GIPELVLKDQKDIALEITVTNSPSNPRDPTKDGDDAHEAKLIATFPDTLTYSAYRELRAY
PEKQLSCAANVNGSQVDCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDVNLKLETTSNQ
DNLASITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGERAMKSEDDIGNLIEYEFRVINL
GKPLKNLGTASLNIQWPKEISNGKWLLYLMKIESKGLEQINCEPQDEINSLGLKESPHNS
RKKREIAEKQTDDGRKFSLFAERKYQTLNCSTNVNCVNIICPLHGLDSKASVILRSRLWN
GTFLEEYSKLNYLDILLQATINVTAAAENIKVPNAGTQVRVTVFPSKTVAQYSGVPWWII
LVAILAGILMLALLVFLLWKCGFFKRSRYDDSVPRYHAVRIRKEERQIKDEKYNDGLEKK
QWITKWNEDESYS
NT seq 3282 nt   +upstreamnt  +downstreamnt
atggcggcttctgggcagctggagctccttttctacctgtcggcgtgtctgctgctccgt
ttctgcgccgcctttaacttggacacccgggaagaaaacgtgatccgcaagatcggggat
cccgagagtctctttggattctccctggccatgcactggcagctacatccgcaggacaag
aggctgttgttggtgggagcccctcgggccaaagcttttcctttacagaaagccaaccgg
acaggaggcctgtacagctgtgacatcacatcccaggcaccttgccaacgcattgaattt
gataacgatgctgacccttattctgagagtaaggaagaccagtggatgggtgtcactgtc
cagagtcaggggccagggggaaaggtcgtgacatgtgcccatcggtatgagagaaggcaa
catgttaacaccaaacaggagtctcgagacataattgggaggtgctatgtgttgagtcag
tctcttaccattgaagatgacatggatggaggagattggagtttttgtgatggccgtttg
agaggtcatgaaaaatttggttcctgtcagcaaggtgtatctgcaacttttactaaagat
ttccattatatagtttttggagctccaggcacttacaattggaaaggaattgttcgtgca
gagcaaaagaataacactttttttgacatgaatatctttgaagatgggccttatgaagtt
ggtggtgagactgatcatgatgaaagtctagttcctgttccagctaacagttatttaggt
ttttcactggattcaggaaaaagtattatctctaaagatgagatcacttttgtgtctggg
gcacctagagccaaccacagtggagctgtggttctcctaaagagagacatgaaatctgca
catctttttactgaacatttgtttgaaggagaagggctggcctcttcatttggttatgat
gtggcagtagtggacctcaacaaagatggctggcaagatatagttgttggagcaccacag
tattttgatagagatggagaagttgggggtgctgtgtacgtctacattaatcagcaaggc
aaatggaataatgtcaagccaattcgccttaatggaaccaaagattctatgtttggcatt
gcagttgaaaacatcggagatattaatcaagatggatacccagatattgcagttggagca
ccttacgatgattttgggaaggtttttatctatcatggctctccaagtggaataaatacc
aagccgacccaggttcttgagggtaaatctcgatactttggttactcaattgctggaaat
atggaccttgacagaaattcctatcctgatgttgctgttggttcactctcagattcagtg
tccattttcagatctcgacctgtgattaacatccagaaaacaatcacagtaacacctaac
agaattgatctgagacacaaaatggcctgtgatgcaccaagtggaatatgcctaaaggtt
aaagcctgttttgaatacactgccaagcccagtagttacaatcctgcaatatcaattgtg
ggcacacttgaagctgaaagtcagagaaggaaatccggcttatcatcaagagttcatttt
ccaaatcaagcttctgaacctaaatcttcccatgaactgactctgaaagggcagaaacaa
aaaatgtgcatggaaagaatactttggctacaggacaacatcagagataaactacgtccc
attcccataacagcatcagtggaaattaaagaaccaaattcacgaaggcgagtgaattca
cttccagaacttcttcccattctgaattcaaatgaacccaaaacagtgacctcagaggtc
cagttcttaaaagagggatgtggagatgacaatatctgtaatagcaatctgaaattagag
tacagattttgtacacgagatggcaaccaagacaaattttcttatttaccaattcacaat
ggcattccagagcttgttctcaaagatcagaaggatattgctttagagataacagtgaca
aatagtccatcaaatcccagggaccctacaaaagatggggatgatgctcatgaagccaaa
ctcattgcaacttttcctgataccttaacttactctgcatacagagagctgagggcttat
cctgaaaaacagttgagttgtgcagctaatgtaaatggttcccaagtagactgtgaactt
ggaaatccctttaagagaaattccagtgttactttttatttgattttaagtaccacggaa
gtcacctttgataccacagacctggacgtgaatttgaagttggaaacaacaagcaatcaa
gataatttggcttcaattacagctaaagctaaagtggttattgaactgcttttgtcggtc
tctggagttgctaaaccttcccaggtgtactttggaggtactgttgttggtgagcgagct
atgaaatctgaagatgatattggaaacttaatagaatatgaattcagggtaattaattta
ggtaaacctcttaaaaatcttggaacagcatctctaaacattcagtggcccaaagaaatt
agcaatggcaaatggctgctttatttgatgaaaatagaatccaaaggactggaacaaata
aactgtgagccacaagatgaaattaattctctgggactaaaggaatctcctcacaactca
agaaagaaaagagaaattgcagagaaacagacagatgatggaagaaaattttctttattt
gcagaaagaaaatatcagacactaaactgtagcacaaatgttaactgtgtgaatataata
tgtcctctacatggtttggacagcaaagcttctgttatattacggtcaaggctgtggaat
ggtacattcctagaggaatattccaagctgaactacttagatattcttcttcaggctacc
attaatgttactgctgctgcagagaatattaaggttccaaatgcaggcactcaagtccgt
gttacagtatttccttcaaagacagttgcacaatattctggagttccttggtggatcatc
cttgtggctatccttgctggaattttgatgcttgctctattagtatttttactatggaag
tgtggattctttaagcgctccaggtacgatgacagtgttccccgataccatgctgtaaga
atccgaaaagaggaacggcagatcaaagatgagaaatataatgatggcctggaaaaaaaa
cagtggatcacaaaatggaatgaagatgaaagctactcctag

KEGG   Sarcophilus harrisii (Tasmanian devil): 100932021
Entry
100932021         CDS       T02286                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04015  Rap1 signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr04611  Platelet activation
shr04640  Hematopoietic cell lineage
shr04810  Regulation of actin cytoskeleton
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
shr05410  Hypertrophic cardiomyopathy
shr05412  Arrhythmogenic right ventricular cardiomyopathy
shr05414  Dilated cardiomyopathy
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100932021 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    100932021 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100932021 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100932021 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100932021 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100932021 (ITGA2B)
   04611 Platelet activation
    100932021 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100932021 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100932021 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100932021 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    100932021 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100932021 (ITGA2B)
   05414 Dilated cardiomyopathy
    100932021 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100932021 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:shr01009]
    100932021 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100932021 (ITGA2B)
   04515 Cell adhesion molecules [BR:shr04515]
    100932021 (ITGA2B)
   04090 CD molecules [BR:shr04090]
    100932021 (ITGA2B)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100932021 (ITGA2B)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100932021 (ITGA2B)
Cell adhesion molecules [BR:shr04515]
 Integrins
  Integrin alpha subunits
   100932021 (ITGA2B)
CD molecules [BR:shr04090]
 Proteins
  100932021 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF997
Other DBs
NCBI-GeneID: 100932021
NCBI-ProteinID: XP_003768450
Ensembl: ENSSHAG00000016072
UniProt: G3WU27
LinkDB
Position
4
AA seq 1057 aa
MVRTHCLLPTLWLLRWIYLLLVLGGVPPAWALNLDAAQPAFYMGPDGSHFGFALDFYQDD
YGGIGIVVGAPRAVGRPGEATGGVFLCPWAAKGSNCSTLKFDLDDKNNSVGAITFKTFKA
NQGLGASVVSWKDIIVACAPWQHWNVLELTEEAGKTPVGSCFVAQPKSGRRAEFAPCREN
AMNQLYLGNYVYLGNYRRDLRYCEVGFSSTVTQSGELVLGAPGGYYFIGLLARAQLSDIM
SSYTTSSLLWTVPSQRLSKDVFKSEYRDAYRGYSVAVGEFNGNPKDTEYVLGVPNWSTTL
GAVEIFYQNHSILHLLQGEQVASYFGHTVAVTDINRDGKDDLLVGAPLFMEQRANRKLAE
VGRVYVYLQLRTPHSLGNPKHLTGTELYGRFGSAIAPLGDLDQDGYNDIAIGAPFGGPNG
RGRVFIFQGQDEGLSPRPSQVLDSPFHQGPGFGFALKGATDIDANGYPDLLVGAFGANQV
AIYRAQPVVWATVRLLVPEVLNPTVKNCTLSNPKTTVAVSCFKIQMCMSITGHSIPEKLR
INAELQLDRMKPRQGRRVLLLGSQQSGTTLDLELSSGHVPFCHDTEAFLRDEAEFRDKLS
PIVISLNVSLKSKGTEGPLPLILNGDTHVQEQTRIILDCGEDDLCVPQLQLKANVEGSPL
VIGADNVLKLQVDTSNEGEGAYEAELAIHLPQGSHFMQALSDIKNFEKLLCIQKKENESQ
LVLCELGNPMKKDAKIRVLMLVSVGNLEEVGDSVSFMLQIKSKNRQNPNSEVFLLEVPVR
AKALVELFGNSFPATLVFSPPPEETLRNKDPTTVNRNTHKMEDASKVEHAFELHNQGPGA
VSGLQLWVGFPSRSESDDLLYVLDIQDHGGLQCSVQPPPNPFNLKVGQPTPAPSSTHAHP
FQHERERRSAFIPEHLGPSGQQEPILVNCDAWPCTWVECKLKQMERGQRAMLTISTMLWM
PGLLKRPLEQFVLQSKAWFNVSGLPYDVPAESLPHGHVVVETKLLQVRLEETEIPTWWVV
VGVIGGLLLLVLLILVMWKVGFFKRNRPPLEEEEEEE
NT seq 3174 nt   +upstreamnt  +downstreamnt
atggttaggactcactgcctgctgcctactctgtggctcttgagatggatatatctgctg
ctggtgctgggtggtgttccccctgcctgggccctaaacctggatgctgcacagccagcc
ttttatatgggtcctgatggcagccactttggatttgctttggatttctaccaggatgac
tatggcggcatcgggatcgtggtaggagccccaagagctgtaggtcgtcctggggaggcg
actggaggtgtgttcctctgtccctgggcagctaagggaagtaactgtagcaccctgaaa
tttgacctcgacgataagaacaacagcgtgggcgccatcactttcaagaccttcaaggct
aatcagggacttggtgcatccgttgtcagttggaaggacatcattgtggcatgcgctccc
tggcagcactggaacgtgctggagctgactgaggaggccggaaagacacctgtcgggagc
tgcttcgtggctcagcccaagagcggccgtcgcgccgagttcgcaccctgccgggagaat
gccatgaaccagctctacctggggaactacgtctacctggggaactaccgcagagacttg
cggtactgcgaagtaggtttcagttccactgtcacccagtctggagagctggttttgggg
gctcctggaggctattatttcataggtctgctagcccgcgctcagctttctgacatcatg
tccagctacaccacatcctcactcctctggacagtgccttcccagcgtctaagcaaggat
gtctttaaatctgagtatcgggacgcctatcgggggtactctgtagccgtgggagaattt
aatggaaatcctaaagatacagaatatgtactgggtgtccccaactggagcacaacactg
ggagcggtggagattttttaccagaaccacagcatcctgcatctgcttcaaggagagcag
gttgcatcatactttgggcacacggtggctgtgactgacatcaacagggatgggaaagat
gacctgctggtaggtgccccactcttcatggagcagagagccaaccgaaagctggcagaa
gtgggacgggtatacgtctacctgcagcttcgaaccccacattccctgggcaaccccaag
catctgactggcactgagttatatgggcgctttggctcagctattgctcctcttggtgat
ctggaccaggatggatacaatgatatagcaataggtgccccatttggaggccccaatgga
cggggccgagtgtttatattccagggacaggatgagggtctgagcccacgaccatcgcag
gttcttgacagccctttccaccaagggcctggctttggctttgccctgaaaggggccact
gacattgatgctaatggatacccagacctgctggtgggagcatttggagccaaccaagtg
gccatatacagggcccagcccgtggtgtgggccactgttcgattactggtgccagaggta
ctgaacccaactgtgaagaactgtacactttccaacccaaagactacagttgcagtcagc
tgtttcaaaatccagatgtgtatgagcatcactggacacagcatcccggagaagcttcgt
ataaatgctgagctgcagctggaccggatgaaaccacgacagggccggcgggtgcttttg
ctgggttctcagcaatcaggcaccactctagacttagaactaagcagtggacatgtccct
ttctgccatgacactgaggctttcttgcgggatgaggctgaattccgagacaagctgagc
cccatcgtgattagccttaatgtatccctaaagagcaagggtactgaagggcccctgccc
ctcatcctgaacggagacactcatgtccaggagcagactcgcatcattctggactgtgga
gaagatgatctctgcgtgccccagttacaactcaaggccaacgtggaaggctctccactt
gtaattggggcagacaacgtgctgaagctgcaagttgacacctccaacgagggggaaggt
gcctacgaggctgagctggccatccatctgccccaaggctcccatttcatgcaggcactg
agtgacatcaagaactttgagaaactactttgtatccagaagaaggagaatgaaagtcaa
ttagtgctgtgtgaactgggcaaccccatgaagaaggatgccaagataagagtccttatg
ctggtgagcgtaggaaacttggaagaagttggggacagtgtctcctttatgctgcagatt
aagagcaagaatcgtcaaaatcccaacagtgaagtttttctactagaggtcccagtcaga
gccaaagcacttgtggagctgtttgggaactctttcccagctaccttagtgttctcccca
cctcctgaggaaaccttgaggaacaaggatccaacaactgtgaatagaaatacccacaaa
atggaagatgcttccaaggtggaacatgcatttgagctccacaaccagggtccaggggca
gtgagtggacttcagctttgggtaggtttccctagccgttctgagagtgatgacctgctc
tacgtgctggatattcaggatcatgggggcctccagtgctctgttcagcctccccccaat
cctttcaatttaaaagttggccaacccacccctgctcccagctctacccacgcccaccct
ttccagcatgaacgagaaagacggagtgcttttatcccagagcatctgggaccctctggg
cagcaagaaccaatacttgtgaattgtgacgcgtggccctgtacctgggtggagtgtaag
ctgaagcagatggagcggggtcagcgggccatgctcaccatatccaccatgctatggatg
cctggcctcctcaagagacctttggaacagtttgtcctgcagtctaaagcctggttcaac
gtctctgggctgccttacgatgtgcctgcagagagcctgcctcatggacatgtcgtggtg
gagaccaaactgcttcaggtacgcctggaagaaacggagatccctacctggtgggtggtc
gtgggtgtgataggtggactacttttgctggtcttgctcatccttgtaatgtggaaggtt
ggcttcttcaaaaggaatcggccacctctagaagaagaggaagaagaggaataa

KEGG   Sarcophilus harrisii (Tasmanian devil): 105749727
Entry
105749727         CDS       T02286                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04145  Phagosome
shr04151  PI3K-Akt signaling pathway
shr04510  Focal adhesion
shr04512  ECM-receptor interaction
shr04611  Platelet activation
shr04640  Hematopoietic cell lineage
shr04810  Regulation of actin cytoskeleton
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05222  Small cell lung cancer
shr05410  Hypertrophic cardiomyopathy
shr05412  Arrhythmogenic right ventricular cardiomyopathy
shr05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    105749727 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    105749727 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    105749727 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    105749727 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    105749727 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    105749727 (ITGA2)
   04611 Platelet activation
    105749727 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105749727 (ITGA2)
   05205 Proteoglycans in cancer
    105749727 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    105749727 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    105749727 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    105749727 (ITGA2)
   05414 Dilated cardiomyopathy
    105749727 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105749727 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    105749727 (ITGA2)
   04515 Cell adhesion molecules [BR:shr04515]
    105749727 (ITGA2)
   04090 CD molecules [BR:shr04090]
    105749727 (ITGA2)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   105749727 (ITGA2)
  Exosomal proteins of bladder cancer cells
   105749727 (ITGA2)
Cell adhesion molecules [BR:shr04515]
 Integrins
  Integrin alpha subunits
   105749727 (ITGA2)
CD molecules [BR:shr04090]
 Proteins
  105749727 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS DUF11 Integrin_alpha HisK_sensor
Other DBs
NCBI-GeneID: 105749727
NCBI-ProteinID: XP_031820769
LinkDB
Position
1
AA seq 1175 aa
MGEVGNWGALLLLSQVILNYCAAYNIGLLEAKIFDGPSTEQFGYAVQQFVNTNGNWLLVG
SPWSGFPENRMGDIYKCPVNLASTMCEKLNLQTVTSISNVTEIKTNMSLGLTLTRNLGTG
GFLTCGPLWAQQCGNQYYATGICSDVSPSFQLLKSFSPAVQSCPSFIDVVVVCDESNSIY
PWSAVKNFLVKFVQGLDIGPDKTQVGLIQYGNYPRVVFNMSTFKTKEEMVKATSQTTQHG
GDLTNTFKAIQYAREFAYSEASGGRPSATKVMVVVTDGESHDGSMLKKVIDQCNDDSILR
FGIAVLGYLNRNALDTKNLIKEIKAIASTPTERYFFNVSDEDALLEKAGTLGERIFSIEG
TVQGGDNFQMEMSQVGFSADYSPENGALTLGAVGAYAWSGTIVQQIPHGYSIFSRQAFEK
VLQDRNHSSYLGYSVAVISTGNSVHFVAGAPRANYTGQVVVYSVNDDGNTTIIQSHRGDQ
IGSYFGSVVCSVDVNRDDITDVLLVGAPMFMNDLKKEEGKVYLFTITKGILNQHQFLEGP
QGLENARFGSAIAALSDINLDGFNDVIVGSPLENENSGAVYIYNGYQRTIRTKYSQKILG
SDPAFRNHLQYFGRALDGYEDLNGDSITDISIGAFGQVVQLWSQSIADVSVEASFTPDKI
NLLNKNAEITLRLCFSANFRPIAQNNQVDIIYNVTLDADRYSSRITSRGLFKENNERYIK
KNIVVYHAPICSEYIINIQEPSDVVNSLNVRVDISLAKPGTSPALEEYSETSKDFSIPFL
KDCGDDGVCISDLVLEVQQITDTQKQPYIVSNQNRRLTFAVTLKNKGEHAYNTRIVTAFS
ENLFFASSSAPVDGTEVSCQLDTSKKVLTCHVGYPSIKSDQQVSFNINFDFNFQNLRNMA
LVSFQALSESQEENEADNRVNFTIPLLYDAEIHLTRSTNINFYEVFSHGNVSSTVKNFDE
IGPIFSFSLKITTGNIPVSMAFVNIAIPQYTKENNTLIYLTGVHVAQDSDISCTAEINPL
KIGETPYSLSFKKENFRDIKELNCKTASCSKITCHLRELRMKEEYFVNVSTRIWNGTFAA
SSFQTIQLVATAKVDTIDSQIYVIEENTIMIPVTIMKPDEKAEVPVGVIIGSIIAGLLLL
LALTTILWKLGFFKRKYEKMAKNPDEIDETTELNS
NT seq 3528 nt   +upstreamnt  +downstreamnt
atgggggaagtcggaaattggggcgctctgttgcttctcagtcaagtcattttaaattat
tgtgctgcatacaacattggtctcctggaagcaaaaatattcgatggtccttcaactgaa
caatttggatatgcagtgcaacagtttgtaaataccaatgggaactggttgcttgttggc
tcaccatggagtggttttccagagaacagaatgggagatatctacaaatgtcctgtcaac
ttagccagtaccatgtgtgaaaaattgaatttacaaactgtaacaagcatttcaaatgtt
actgagataaaaacaaatatgagtcttggcttgacacttacacggaacttgggaactgga
gggtttctgacatgtggacctctgtgggcccagcagtgtggaaatcaatattatgcaact
ggcatctgttctgatgttagtcccagtttccaactcctcaagagtttttcacctgcagtt
caatcctgcccatccttcattgatgttgtggttgtatgtgatgaatcaaacagcatttat
ccctggagtgcagtaaaaaattttttggtcaaatttgtgcaaggtctggatataggtcct
gacaagacccaggtgggactaattcagtatggaaattatccacgagttgtcttcaacatg
agtacttttaaaacaaaagaagaaatggttaaagcaacatctcaaacaacccaacatggt
ggagatctcactaatactttcaaagcaattcaatatgccagagaatttgcttattctgaa
gcctctggtggacgacccagtgctaccaaagttatggtggttgtgacagatggtgaatct
catgatggctctatgttgaaaaaagttattgatcaatgcaatgatgatagcatacttaga
tttggcatagcagtccttggatacttaaatagaaatgcacttgacacaaagaatttaata
aaagaaatcaaagcaattgctagtactccaacagagagatatttttttaatgtttctgat
gaagatgcactcttggaaaaggctgggacattgggcgagcgtattttcagcattgaaggt
actgttcaaggaggtgataactttcagatggaaatgtcacaagttggtttcagtgcagat
tactctcctgaaaatggtgctctgacactgggtgcagttggagcatatgcctggagtgga
acaattgtgcaacagataccccatggatattccatcttctctagacaagcatttgaaaaa
gttctgcaagatagaaatcacagttcatatttaggatattctgttgcagttatttctact
ggtaatagtgtccattttgttgctggtgctccccgggcaaattatactggccaagtagtg
gtatatagtgttaatgatgatggtaatactacaatcattcaatctcatagaggtgaccag
attggatcctactttggcagtgtggtgtgttcggttgacgtaaatagagatgatatcaca
gatgtgcttttggtgggtgcaccaatgttcatgaatgaccttaagaaagaggaagggaag
gtctacctattcactatcacaaagggaattttgaatcaacatcaattcctcgaaggtcct
cagggtttggaaaatgcccggtttggctcagccattgctgctctttcagacattaatttg
gatggttttaatgatgttattgtgggctcaccccttgaaaatgagaactctggagctgtt
tacatttacaatggatatcagaggactatacgaactaaatactctcagaaaattttaggg
tcagatcctgcctttagaaatcatctccagtattttggaagagcattagatggctatgaa
gatctgaatggagattcaataactgacatatccattggtgcctttggacaagtggttcaa
ctctggtcacagagtattgctgatgtctctgtagaagcttcatttacccctgataagatc
aatttgttgaacaagaatgctgaaataaccctcagattgtgcttcagtgcaaatttcaga
cctattgcacaaaacaaccaagtggatattatctacaatgtaacacttgatgctgatcgt
tattcttctagaataacttctaggggattgtttaaagaaaacaatgaaagatacattaag
aaaaacatagtggtatatcatgcacctatttgttcagagtacatcatcaacatacaggaa
ccttctgatgttgtcaactccttaaatgttcgagtagacatcagtttggcaaagcccggt
acaagtcctgctctggaagagtattctgagacttcaaaggacttcagtatacctttttta
aaagactgtggggatgatggagtatgcatctctgatctcgtccttgaagttcaacaaata
acagatactcaaaaacagccatatattgtcagcaaccaaaacagaaggttaacatttgca
gtaacgctgaaaaacaaaggggaacatgcctataacaccagaattgttactgctttttca
gaaaacttgttttttgcctcatcttctgcaccggttgatgggactgaagtttcatgtcag
ttggacacttccaagaaggttctcacctgtcatgttggctatccttctatcaagagtgat
cagcaggtgtcttttaatataaactttgacttcaatttccaaaatcttcggaacatggca
cttgtcagttttcaagctttaagtgagagtcaagaagaaaatgaagcagacaatagagtc
aactttacaattcccttgctgtatgatgcagaaattcatttaacgaggtctaccaatatc
aatttttatgaagtcttttctcatggcaatgtttcctccactgtgaaaaactttgatgaa
attggccctattttcagtttttcacttaagatcacaacgggaaacattccagtatccatg
gcttttgtaaacatcgccattcctcaatacaccaaagaaaataatacattgatctatttg
acaggagtgcatgtagcacaggacagtgatatcagctgtactgcagaaataaatccatta
aaaataggagaaacaccttattcattgtcttttaagaaagaaaacttccgagatattaaa
gaattgaactgcaaaactgcatcatgtagtaaaatcacctgccacctgagagaactcaga
atgaaagaagaatactttgtgaatgtgtctaccagaatctggaatggaacttttgcagct
tcatctttccagacaattcagctggtagcaactgcaaaagtggacacaattgactcacaa
atatatgtaattgaagaaaacactattatgattccagttacaataatgaagcctgatgag
aaagctgaagtaccagtaggagttatcattggaagtataattgctggccttctcttgctg
ttagccctaactactattttgtggaagcttggttttttcaagaggaaatatgagaaaatg
gccaaaaatccagatgaaattgatgagactacagaactaaatagctga

DBGET integrated database retrieval system