KEGG   Sarcophilus harrisii (Tasmanian devil): 100928380
Entry
100928380         CDS       T02286                                 

Gene name
GRB2
Definition
(RefSeq) growth factor receptor-bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04010  MAPK signaling pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04062  Chemokine signaling pathway
shr04068  FoxO signaling pathway
shr04072  Phospholipase D signaling pathway
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04380  Osteoclast differentiation
shr04510  Focal adhesion
shr04540  Gap junction
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04630  JAK-STAT signaling pathway
shr04650  Natural killer cell mediated cytotoxicity
shr04660  T cell receptor signaling pathway
shr04662  B cell receptor signaling pathway
shr04664  Fc epsilon RI signaling pathway
shr04714  Thermogenesis
shr04722  Neurotrophin signaling pathway
shr04910  Insulin signaling pathway
shr04912  GnRH signaling pathway
shr04915  Estrogen signaling pathway
shr04917  Prolactin signaling pathway
shr04926  Relaxin signaling pathway
shr04935  Growth hormone synthesis, secretion and action
shr05034  Alcoholism
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05211  Renal cell carcinoma
shr05213  Endometrial cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05220  Chronic myeloid leukemia
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100928380 (GRB2)
   04012 ErbB signaling pathway
    100928380 (GRB2)
   04014 Ras signaling pathway
    100928380 (GRB2)
   04630 JAK-STAT signaling pathway
    100928380 (GRB2)
   04068 FoxO signaling pathway
    100928380 (GRB2)
   04072 Phospholipase D signaling pathway
    100928380 (GRB2)
   04151 PI3K-Akt signaling pathway
    100928380 (GRB2)
   04150 mTOR signaling pathway
    100928380 (GRB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100928380 (GRB2)
   04540 Gap junction
    100928380 (GRB2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100928380 (GRB2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100928380 (GRB2)
   04660 T cell receptor signaling pathway
    100928380 (GRB2)
   04662 B cell receptor signaling pathway
    100928380 (GRB2)
   04664 Fc epsilon RI signaling pathway
    100928380 (GRB2)
   04062 Chemokine signaling pathway
    100928380 (GRB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100928380 (GRB2)
   04912 GnRH signaling pathway
    100928380 (GRB2)
   04915 Estrogen signaling pathway
    100928380 (GRB2)
   04917 Prolactin signaling pathway
    100928380 (GRB2)
   04926 Relaxin signaling pathway
    100928380 (GRB2)
   04935 Growth hormone synthesis, secretion and action
    100928380 (GRB2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100928380 (GRB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100928380 (GRB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100928380 (GRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100928380 (GRB2)
   05206 MicroRNAs in cancer
    100928380 (GRB2)
   05205 Proteoglycans in cancer
    100928380 (GRB2)
   05203 Viral carcinogenesis
    100928380 (GRB2)
   05231 Choline metabolism in cancer
    100928380 (GRB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100928380 (GRB2)
   05225 Hepatocellular carcinoma
    100928380 (GRB2)
   05226 Gastric cancer
    100928380 (GRB2)
   05214 Glioma
    100928380 (GRB2)
   05221 Acute myeloid leukemia
    100928380 (GRB2)
   05220 Chronic myeloid leukemia
    100928380 (GRB2)
   05211 Renal cell carcinoma
    100928380 (GRB2)
   05215 Prostate cancer
    100928380 (GRB2)
   05213 Endometrial cancer
    100928380 (GRB2)
   05224 Breast cancer
    100928380 (GRB2)
   05223 Non-small cell lung cancer
    100928380 (GRB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100928380 (GRB2)
   05160 Hepatitis C
    100928380 (GRB2)
   05163 Human cytomegalovirus infection
    100928380 (GRB2)
   05165 Human papillomavirus infection
    100928380 (GRB2)
  09165 Substance dependence
   05034 Alcoholism
    100928380 (GRB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100928380 (GRB2)
   01522 Endocrine resistance
    100928380 (GRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100928380 (GRB2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:shr04990]
    100928380 (GRB2)
Membrane trafficking [BR:shr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    100928380 (GRB2)
Domain-containing proteins not elsewhere classified [BR:shr04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   100928380 (GRB2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_10 SH3_3 SH2_2 hSH3 DUF5093 SH3_4
Other DBs
NCBI-GeneID: 100928380
NCBI-ProteinID: XP_031821647
Ensembl: ENSSHAG00000018383
LinkDB
Position
4
AA seq 217 aa
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPW
FFGKIPRAKAEEMLGKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRG
DFIQVLDNSDPNWWKGACHGQTGMFPRNYVTPVNRNI
NT seq 654 nt   +upstreamnt  +downstreamnt
atggaagccatcgccaaatacgacttcaaagccactgcagatgacgagttgagcttcaaa
aggggtgacatcctcaaggtattgaatgaagaatgtgatcaaaattggtataaagcagaa
cttaatggaaaagatggcttcattcccaaaaactacatagaaatgaaaccacatccgtgg
ttttttggcaaaatccccagagcaaaggcagaagaaatgcttggcaaacagcgacatgat
ggtgcctttcttatccgggagagcgagagtgcacccggggacttctccctctctgtcaag
tttggaaatgatgtgcagcatttcaaggtgctccgagatggggctgggaagtattttctt
tgggtggtaaagttcaattctttaaatgagctggtagattatcacagatccacctcagtt
tccagaaaccagcagatattcttgagggacatagaacaggtgccacagcaaccaacatat
gtccaggccctctttgactttgacccccaagaagatggagagctgggcttccgtcgggga
gatttcatacaggtcctcgataactcagaccccaattggtggaaaggagcctgccatggc
cagaccggcatgtttccacgtaactacgtcaccccagtgaaccggaacatctaa

DBGET integrated database retrieval system