Sarcophilus harrisii (Tasmanian devil): 100928986 Help Entry 100928986         CDS       T02286                                  Gene name NRAS Definition (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr01521   EGFR tyrosine kinase inhibitor resistance shr01522   Endocrine resistance shr04010   MAPK signaling pathway shr04012   ErbB signaling pathway shr04014   Ras signaling pathway shr04015   Rap1 signaling pathway shr04062   Chemokine signaling pathway shr04068   FoxO signaling pathway shr04071   Sphingolipid signaling pathway shr04072   Phospholipase D signaling pathway shr04137   Mitophagy - animal shr04140   Autophagy - animal shr04150   mTOR signaling pathway shr04151   PI3K-Akt signaling pathway shr04210   Apoptosis shr04211   Longevity regulating pathway shr04213   Longevity regulating pathway - multiple species shr04218   Cellular senescence shr04360   Axon guidance shr04370   VEGF signaling pathway shr04371   Apelin signaling pathway shr04540   Gap junction shr04550   Signaling pathways regulating pluripotency of stem cells shr04625   C-type lectin receptor signaling pathway shr04650   Natural killer cell mediated cytotoxicity shr04660   T cell receptor signaling pathway shr04662   B cell receptor signaling pathway shr04664   Fc epsilon RI signaling pathway shr04714   Thermogenesis shr04720   Long-term potentiation shr04722   Neurotrophin signaling pathway shr04725   Cholinergic synapse shr04726   Serotonergic synapse shr04730   Long-term depression shr04810   Regulation of actin cytoskeleton shr04910   Insulin signaling pathway shr04912   GnRH signaling pathway shr04915   Estrogen signaling pathway shr04916   Melanogenesis shr04917   Prolactin signaling pathway shr04919   Thyroid hormone signaling pathway shr04921   Oxytocin signaling pathway shr04926   Relaxin signaling pathway shr04929   GnRH secretion shr04933   AGE-RAGE signaling pathway in diabetic complications shr04935   Growth hormone synthesis, secretion and action shr05010   Alzheimer disease shr05022   Pathways of neurodegeneration - multiple diseases shr05034   Alcoholism shr05160   Hepatitis C shr05161   Hepatitis B shr05163   Human cytomegalovirus infection shr05165   Human papillomavirus infection shr05166   Human T-cell leukemia virus 1 infection shr05167   Kaposi sarcoma-associated herpesvirus infection shr05170   Human immunodeficiency virus 1 infection shr05200   Pathways in cancer shr05203   Viral carcinogenesis shr05205   Proteoglycans in cancer shr05206   MicroRNAs in cancer shr05210   Colorectal cancer shr05211   Renal cell carcinoma shr05213   Endometrial cancer shr05214   Glioma shr05215   Prostate cancer shr05216   Thyroid cancer shr05218   Melanoma shr05219   Bladder cancer shr05220   Chronic myeloid leukemia shr05221   Acute myeloid leukemia shr05223   Non-small cell lung cancer shr05224   Breast cancer shr05225   Hepatocellular carcinoma shr05226   Gastric cancer shr05230   Central carbon metabolism in cancer shr05231   Choline metabolism in cancer shr05235   PD-L1 expression and PD-1 checkpoint pathway in cancer Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100928986 (NRAS)    04012 ErbB signaling pathway     100928986 (NRAS)    04014 Ras signaling pathway     100928986 (NRAS)    04015 Rap1 signaling pathway     100928986 (NRAS)    04370 VEGF signaling pathway     100928986 (NRAS)    04371 Apelin signaling pathway     100928986 (NRAS)    04068 FoxO signaling pathway     100928986 (NRAS)    04072 Phospholipase D signaling pathway     100928986 (NRAS)    04071 Sphingolipid signaling pathway     100928986 (NRAS)    04151 PI3K-Akt signaling pathway     100928986 (NRAS)    04150 mTOR signaling pathway     100928986 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100928986 (NRAS)    04137 Mitophagy - animal     100928986 (NRAS)   09143 Cell growth and death    04210 Apoptosis     100928986 (NRAS)    04218 Cellular senescence     100928986 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     100928986 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     100928986 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100928986 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100928986 (NRAS)    04650 Natural killer cell mediated cytotoxicity     100928986 (NRAS)    04660 T cell receptor signaling pathway     100928986 (NRAS)    04662 B cell receptor signaling pathway     100928986 (NRAS)    04664 Fc epsilon RI signaling pathway     100928986 (NRAS)    04062 Chemokine signaling pathway     100928986 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     100928986 (NRAS)    04929 GnRH secretion     100928986 (NRAS)    04912 GnRH signaling pathway     100928986 (NRAS)    04915 Estrogen signaling pathway     100928986 (NRAS)    04917 Prolactin signaling pathway     100928986 (NRAS)    04921 Oxytocin signaling pathway     100928986 (NRAS)    04926 Relaxin signaling pathway     100928986 (NRAS)    04935 Growth hormone synthesis, secretion and action     100928986 (NRAS)    04919 Thyroid hormone signaling pathway     100928986 (NRAS)    04916 Melanogenesis     100928986 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     100928986 (NRAS)    04726 Serotonergic synapse     100928986 (NRAS)    04720 Long-term potentiation     100928986 (NRAS)    04730 Long-term depression     100928986 (NRAS)    04722 Neurotrophin signaling pathway     100928986 (NRAS)   09158 Development and regeneration    04360 Axon guidance     100928986 (NRAS)   09149 Aging    04211 Longevity regulating pathway     100928986 (NRAS)    04213 Longevity regulating pathway - multiple species     100928986 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     100928986 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100928986 (NRAS)    05206 MicroRNAs in cancer     100928986 (NRAS)    05205 Proteoglycans in cancer     100928986 (NRAS)    05203 Viral carcinogenesis     100928986 (NRAS)    05230 Central carbon metabolism in cancer     100928986 (NRAS)    05231 Choline metabolism in cancer     100928986 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100928986 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     100928986 (NRAS)    05225 Hepatocellular carcinoma     100928986 (NRAS)    05226 Gastric cancer     100928986 (NRAS)    05214 Glioma     100928986 (NRAS)    05216 Thyroid cancer     100928986 (NRAS)    05221 Acute myeloid leukemia     100928986 (NRAS)    05220 Chronic myeloid leukemia     100928986 (NRAS)    05218 Melanoma     100928986 (NRAS)    05211 Renal cell carcinoma     100928986 (NRAS)    05219 Bladder cancer     100928986 (NRAS)    05215 Prostate cancer     100928986 (NRAS)    05213 Endometrial cancer     100928986 (NRAS)    05224 Breast cancer     100928986 (NRAS)    05223 Non-small cell lung cancer     100928986 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     100928986 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     100928986 (NRAS)   09165 Substance dependence    05034 Alcoholism     100928986 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100928986 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100928986 (NRAS)    05170 Human immunodeficiency virus 1 infection     100928986 (NRAS)    05161 Hepatitis B     100928986 (NRAS)    05160 Hepatitis C     100928986 (NRAS)    05163 Human cytomegalovirus infection     100928986 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     100928986 (NRAS)    05165 Human papillomavirus infection     100928986 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100928986 (NRAS)    01522 Endocrine resistance     100928986 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:shr04131]     100928986 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:shr04147]     100928986 (NRAS)    04031 GTP-binding proteins [BR:shr04031]     100928986 (NRAS) Membrane trafficking [BR:shr04131]  Endocytosis   Macropinocytosis    Ras GTPases     100928986 (NRAS) Exosome [BR:shr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100928986 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    100928986 (NRAS)   Exosomal proteins of breast cancer cells    100928986 (NRAS)   Exosomal proteins of colorectal cancer cells    100928986 (NRAS) GTP-binding proteins [BR:shr04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100928986 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N Septin ParA Ldh_1_N Motif Other DBs NCBI-GeneID:  100928986 NCBI-ProteinID:  XP_031823205 LinkDB All DBs Position 4 AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CLGLSCSVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaaactggtggtggtcggagctggcggtgtcgggaaaagcgccttgacc atccagctcatccagaaccacttcgtagacgagtatgatcccacgatagaggactcctat cgcaagcaagtggttattgatggtgaaacctgtttgttggacatacttgacacagctgga caagaagagtatagtgccatgagagaccagtatatgaggacaggcgaaggctttctctgt gtctttgccatcaacaatagcaaatcatttgcagacattaacctctacagggaacaaatt aaacgagtgaaagattcagatgatgtgcctatggtgctggtgggaaataagtgtgatctg ccaacacggacagttgacacaaaacaggctcatgaactagccaagagctatggaattcct ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta agagaaatacgacagtaccgcatgaaaaaactcaacagtagcgatgatgggactcaaggc tgcctgggtctttcatgttcagtcatgtaa

DBGET integrated database retrieval system