KEGG   Sarcophilus harrisii (Tasmanian devil): 100929408Help
Entry
100929408         CDS       T02286                                 

Gene name
MGST3
Definition
(RefSeq) microsomal glutathione S-transferase 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00480  Glutathione metabolism
shr00980  Metabolism of xenobiotics by cytochrome P450
shr00982  Drug metabolism - cytochrome P450
shr00983  Drug metabolism - other enzymes
shr01524  Platinum drug resistance
shr05200  Pathways in cancer
shr05204  Chemical carcinogenesis
shr05225  Hepatocellular carcinoma
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100929408 (MGST3)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100929408 (MGST3)
   00982 Drug metabolism - cytochrome P450
    100929408 (MGST3)
   00983 Drug metabolism - other enzymes
    100929408 (MGST3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100929408 (MGST3)
   05204 Chemical carcinogenesis
    100929408 (MGST3)
   05225 Hepatocellular carcinoma
    100929408 (MGST3)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100929408 (MGST3)
  Drug resistance
   01524 Platinum drug resistance
    100929408 (MGST3)
Enzymes [BR:shr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100929408 (MGST3)
Transporters [BR:shr02000]
 Other Transporters
  Pores ion channels [TC:1]
   100929408 (MGST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 100929408
NCBI-ProteinID: XP_003767426
Ensembl: ENSSHAG00000016309
LinkDB All DBs
Position
4
AA seq 152 aa AA seqDB search
MAVLSKEYGFVILTGAASFMLVTHLAINVGKARKKYKVEYPNMYSTDPENGHIFNCIQRA
HQNTLEVYPSYLFFLTIGGIYHPRLVSGLGLAWIIGRVLYAYGYYTGDPSKRSRGMVGSI
ALLGLMGTVVYSAFQHLGWVNRGLCHGSKSCH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcagttctctcaaaggaatatggttttgtgattctcactggtgctgccagtttcatg
ttggtcactcaccttgccatcaatgtaggcaaagcccggaagaagtacaaggtggagtat
cccaatatgtacagtactgatcctgaaaatgggcacattttcaactgcattcagagagct
caccagaatacattggaagtatatccttcctatttattctttctaactattggaggcatt
taccatcctcgcttagtttctggcttgggattggcatggatcattggacgtgtgctttat
gcttatggctattacacaggagacccaagcaaacggagtcgaggaatggtgggttccatt
gctctcctagggctgatgggtacagttgtgtactctgctttccagcatcttggttgggtg
aaccgaggcttgtgccatggatctaagagttgtcactga

DBGET integrated database retrieval system