KEGG   Sarcophilus harrisii (Tasmanian devil): 100929695
Entry
100929695         CDS       T02286                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04010  MAPK signaling pathway
shr04014  Ras signaling pathway
shr04015  Rap1 signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04390  Hippo signaling pathway
shr04810  Regulation of actin cytoskeleton
shr05200  Pathways in cancer
shr05218  Melanoma
shr05224  Breast cancer
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100929695 (FGF1)
   04014 Ras signaling pathway
    100929695 (FGF1)
   04015 Rap1 signaling pathway
    100929695 (FGF1)
   04390 Hippo signaling pathway
    100929695 (FGF1)
   04151 PI3K-Akt signaling pathway
    100929695 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100929695 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100929695 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100929695 (FGF1)
   05218 Melanoma
    100929695 (FGF1)
   05224 Breast cancer
    100929695 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:shr04052]
    100929695 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:shr00536]
    100929695 (FGF1)
Cytokines and growth factors [BR:shr04052]
 Growth factors
  Growth factors (RTK binding)
   100929695 (FGF1)
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100929695 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100929695
NCBI-ProteinID: XP_003756738
Ensembl: ENSSHAG00000009313
UniProt: G3W5U8
LinkDB
Position
2
AA seq 155 aa
MAEGEITTFTALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRNDQHIQLQ
LSAESVGEVYIKSTESGQYLAMDTDGLLYGSQTPTEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSE
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgaaggggagatcacaaccttcacagccctgaccgaaagatttaatctgccactg
gggaattacaagaagcccaagcttctctactgtagcaatgggggccactttttgaggatt
cttcctgatggtaaagtggatgggacaagggacagaaatgatcaacacattcaactgcaa
ctaagcgcggaaagcgtgggtgaggtgtatataaagagcactgagtctggccagtatttg
gctatggacaccgatggacttttatacggctcacagacacccactgaagaatgcttgttc
ctggagagattggaggagaatcattacaacacctacatatcaaagaagcatgcggagaaa
aattggtttgtgggcctcaagaaaaatggaagctgcaaaagaggtcccaggactcactat
ggccagaaagccatcctcttccttcccctccctgtgtcctctgagtaa

DBGET integrated database retrieval system