KEGG   Sarcophilus harrisii (Tasmanian devil): 100929943Help
Entry
100929943         CDS       T02286                                 

Definition
(RefSeq) cationic trypsin-3-like isoform X1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04080  Neuroactive ligand-receptor interaction
shr04972  Pancreatic secretion
shr04974  Protein digestion and absorption
shr05164  Influenza A
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100929943
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    100929943
   04974 Protein digestion and absorption
    100929943
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    100929943
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:shr01002]
    100929943
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100929943
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100929943
Peptidases [BR:shr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100929943
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100929943
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 100929943
NCBI-ProteinID: XP_003772482
Ensembl: ENSSHAG00000004936
UniProt: G3VR43
LinkDB All DBs
Position
5
AA seq 247 aa AA seqDB search
MKAIIFLALLGAAVAYSASDDDDKIVGGYTCAPNSLPYQVSLNAGYHFCGGSLINEQWVV
SAAHCYKSRIQVRLGEHNIDVIEGGEQFIDSAKVIRHPNYNSYMIDNDIMLIKLKTPATL
SSRVSTISLPKYCAAVGTSCLISGWGNTLSSGVNYPELLQCLNAPLLSDATCRKAYPGQI
TDNMICLGYLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKGKPGVYTKVCNYVNWI
KKTIAEN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccattatcttccttgccctcctgggggctgctgttgcctattccgctagtgat
gatgatgacaagattgttggaggctacacatgtgcccctaactccctcccctatcaggtg
tctctgaatgctggctaccatttctgtggtggttctctcatcaatgaacagtgggtggta
tcagctgctcattgctacaagtcccgaatccaggtgagactgggagagcacaacattgac
gtcattgaaggtggtgagcagttcattgattcagctaaagtgatccgacatcctaactac
aattcttacatgattgacaatgacatcatgctgattaagctgaaaacacctgccaccctc
agctctcgagtctctaccatctccctgcctaaatactgtgctgctgttggaacttcatgt
ctcatctctggctggggcaatactttaagttctggtgtcaactacccagaactgcttcag
tgtctgaatgcccccctgctttctgatgctacctgccgcaaagcctaccctggacagatc
accgacaacatgatctgcttgggctatctggagggtggaaaggattcctgccagggtgat
tccggtggccctgtggtctgcaatggagaacttcaaggaattgtctcctggggttatggt
tgtgctcagaaaggcaaacctggtgtctacactaaggtctgcaactatgtgaattggatt
aagaagaccattgcagaaaactaa

DBGET integrated database retrieval system