KEGG   Sarcophilus harrisii (Tasmanian devil): 100930034Help
Entry
100930034         CDS       T02286                                 

Gene name
FADS2
Definition
(RefSeq) fatty acid desaturase 2
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00592  alpha-Linolenic acid metabolism
shr01040  Biosynthesis of unsaturated fatty acids
shr01100  Metabolic pathways
shr01212  Fatty acid metabolism
shr03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    100930034 (FADS2)
   01040 Biosynthesis of unsaturated fatty acids
    100930034 (FADS2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100930034 (FADS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:shr01004]
    100930034 (FADS2)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     100930034 (FADS2)
Lipid biosynthesis proteins [BR:shr01004]
 Desaturase
  Front-end
   100930034 (FADS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 100930034
NCBI-ProteinID: XP_023362494
LinkDB All DBs
Position
6
AA seq 545 aa AA seqDB search
CFHSLPFSCSVPEASGLLLHPGGPSRLRDPAPQGPGSEMEKPSYISDAFLAFHQDLHFVR
KFMKPLLVGELAPGEPSQDRDKSPQITEDFRTLKKTAEDMKLFETNHMFFLLLLAHIIVM
EGLAWFTVFYFGTGWISTILTAVILAISQAQAGWLQHDYGHLSVYQKSTWNHFFHKFVIG
HLKGASANWWNHRHFQHHAKPNTFQKDPDVNMLHVFVLGEWQPVEVRRGGGRDPEAHGLF
HLHALLCLAVQVQKPARAVLALNASRRGRPWALTQRGSWLSGTGNSVHLSGFAPWMSLPE
GPSPARGVVRQISSTRYRHGRGRGSRPQCPPCAHAEGAWGGKVTEGSGPHPPPFSVSALS
SPPTVGPPLLIPLYFQFQIIMTMIVRRDWVDLAWAISYYTRFFFTYIPFYGILGSLCFLN
FIRFLESHWFVWVTQMNHIPMDIDREKYQDWFSSQISSMVLSDPQFLPPGERGPQGFPCS
HLSPFPSLFPTMPRHNYYKVAPLVKSLCAKHGILYQEKPLMRALLDIVGSLKKSGDLWLD
AYLHK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
tgcttccattccctgcccttcagctgttctgttcccgaggcctctgggctgctgctccat
ccaggtggcccatcccgcctcagggacccagctccccagggaccgggctctgaaatggag
aagccgagttacatcagtgacgctttcctcgccttccaccaggacctgcattttgtgagg
aagttcatgaagcccctgctggttggggagctggcccctggggagcccagccaagaccgt
gacaagagtccccagattaccgaggacttccgaaccctgaagaagactgcggaagacatg
aagctctttgagaccaaccatatgttcttcctcctgctcctggcccacatcatcgtcatg
gagggtctagcctggttcaccgtcttctactttggcaccggctggatctccaccatcttg
acagccgtcatcctggcaatttcccaggcccaggctggatggctccagcatgactacggt
cacctctcggtctaccagaaatccacgtggaaccactttttccacaaatttgtgatcggc
cacctcaagggagcttcggccaactggtggaatcatcggcactttcagcaccacgccaag
cccaacacctttcagaaggaccccgacgtgaacatgctccacgtctttgtcctgggcgag
tggcagccggtggaggtaagaagaggaggagggagggaccctgaggctcacggccttttc
cacctgcacgctttgctctgcctcgctgtccaggtacagaagccggccagagcagttctg
gccctgaacgcgtcccgccggggccgaccctgggccttgacacaacgcgggtcttggctg
agcgggacaggaaacagcgtccacttgagtgggtttgccccatggatgtccctgcccgag
ggtccctcccccgccaggggtgtagtacggcagatttcctcaacacgataccgtcatggc
cgtggtcgagggagtcggccccagtgccctccctgtgcccatgcagaaggggcttggggc
gggaaggtcacggaggggtcgggcccccaccccccgcccttctcagtgtctgccctttct
tctcctcccacagttgggcccccgctgctcatccccttgtacttccagttccagatcatc
atgaccatgattgtgcgcagagattgggtggacctggcctgggccatcagttactacacc
cgcttcttcttcacctacatccctttctatggaatcctgggatccctctgtttcctcaac
ttcatcagattcctggaaagccactggttcgtgtgggtcacgcagatgaatcacatcccc
atggacatcgatcgggagaagtaccaggactggttcagtagccagatttcctcaatggtc
ctctctgaccctcagtttcttcccccaggggaaaggggcccgcagggtttcccctgctca
catctctctcccttccccagtctcttccccaccatgccgcgccacaattactacaaggtc
gccccgctggtcaagtctctgtgtgcaaagcacggcatcctgtaccaagagaagcccctc
atgagagccctcttggacattgtggggtccttgaagaagtcgggagacctctggctggat
gcttacctccacaaatga

DBGET integrated database retrieval system