KEGG   Sarcophilus harrisii (Tasmanian devil): 100930047Help
Entry
100930047         CDS       T02286                                 

Gene name
ABL1
Definition
(RefSeq) tyrosine-protein kinase ABL1 isoform X2
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04012  ErbB signaling pathway
shr04014  Ras signaling pathway
shr04110  Cell cycle
shr04360  Axon guidance
shr04722  Neurotrophin signaling pathway
shr05200  Pathways in cancer
shr05206  MicroRNAs in cancer
shr05220  Chronic myeloid leukemia
shr05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100930047 (ABL1)
   04012 ErbB signaling pathway
    100930047 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100930047 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100930047 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    100930047 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100930047 (ABL1)
   05206 MicroRNAs in cancer
    100930047 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100930047 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100930047 (ABL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100930047 (ABL1)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100930047 (ABL1)
Protein kinases [BR:shr01001]
 Non-receptor tyrosine kinases
  ABL family
   100930047 (ABL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F_actin_bind SH2 SH3_1 SH3_9 SH3_2 SH3_3 Haspin_kinase SH3_6
Motif
Other DBs
NCBI-GeneID: 100930047
NCBI-ProteinID: XP_012409423
Ensembl: ENSSHAG00000016375
LinkDB All DBs
Position
1
AA seq 1128 aa AA seqDB search
MKMLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVTASDFEPQGLSEAARWNSKENLLAG
PSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYIT
PVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRIN
TASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTIYGVSPNYDKWEI
ERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPN
LVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKK
NFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFS
IKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKNYRMERPEGCPEKVYELMRACWQ
WSPSDRPSFAEIHQAFETMFQESSISDEVEKELGKKVVRSVVSTLLQAPELPTKTRTSRR
AAENKDTSELLDTSHLRSQGEDLLDHEPAVSPLLPRKERVPQDSNLNEDERLLPKDKKTN
LFSALIKKKKKTAPTPPKRSSSFREMDGHSDRRAGGEDETRDILNGTFITAPSDAAESSK
FPSPSNGLNVSNGAVSGSSGFRSPHLWKKSIASASSRLATNEEESSSNSSKRFLRSCSAS
CVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRASENKSDVTSRGTV
TPPPRLLKQNEEGVDDVFKDTESSPGSSPPSLTPKLVRKQVTVTVSSGLSHKEETGKTSA
LGAPAALEQVPVSKAASSAFMGTSKVSSEEPRGRRHKHSSESLGKDKGKLSRLKPAPPPP
PSSSAGKSTKPSHDTAGDVGPSLKAKQLTMVADAGNSDAAKSNQLGEGVKKPALSSAPKP
PSSNKPSAAPLTTPATSPSTLPSASSVLGGEQLSSTAFVPLISTRVSLRKTRQPPERLAS
GAITKGVVLDSTEALCLAISKNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNKFAFR
EAINKLENNLRELQICPATAGSGPAATQDFSKLLNSVKEISDIVQRLL
NT seq 3387 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgttggagatctgtttgaagttggtgggttgcaagtcaaagaagggactttcc
tcttcctccagctgttatttggaagaagctcttcagaggccagtaactgcatctgatttt
gagccacaaggtctgagtgaagcagctcgttggaactccaaagaaaaccttcttgctggt
cccagtgaaaatgaccctaacctttttgttgcactgtatgattttgtggccagtggggat
aacactctaagtataactaaaggtgaaaagctccgtgtcttgggctataatcacaatgga
gaatggtgtgaagcacaaaccaaaaatggacaagggtgggttccaagcaactatatcacc
ccagtcaacagtttggagaaacattcctggtaccatgggcctgtatcacgaaatgctgct
gaatacctgctgagcagtggaatcaatggcagctttctggttcgagagagtgagagcagc
ccaggccagcggtccatttcactaagatatgaaggaagggtgtaccactacaggataaat
acagcatctgatggaaagctgtacgtctcttcagaaagccgctttaatactttggcagag
ttggttcatcaccattcaacggtggcagatggattgatcactactctgcattacccagct
cccaaaagaaacaaacccaccatatatggagtgtctcctaactacgataagtgggaaatt
gagcggacagacattaccatgaaacacaaacttggaggagggcagtatggagaagtgtat
gaaggtgtatggaaaaaatatagcttaactgtagctgtgaaaaccctgaaggaagatact
atggaggtggaagagttcttgaaagaagctgcagtaatgaaagagatcaaacaccctaac
ttagtacaattactaggggtttgtactcgggaacccccattttatataatcacagagttc
atgacctatgggaatctgttagattatctacgagaatgtaatcggcaggaggtgaatgca
gttgtgctactatacatggccactcagatctcatcagctatggagtacctggagaagaaa
aacttcatccacagggatcttgctgcccgaaactgccttgtaggagaaaaccacttggtg
aaggtggctgattttggcttgagcaggttaatgacaggagacacctatacagcccatgct
ggagctaagttcccaatcaaatggacagcacctgaaagcctggcttataataagttttcc
attaagtcagatgtctgggcatttggtgttttgctttgggaaattgctacatatggtatg
tccccttatcctggaattgatctgtcacaagtgtatgaattattggaaaaaaactatcgc
atggagcgtccagaaggctgtccagaaaaagtctatgaactcatgagagcatgttggcag
tggagtccttctgaccggccctcctttgctgaaatccaccaagcctttgaaacgatgttt
caggagtccagcatctcagacgaagtggaaaaagagttggggaagaaagttgtacgaagt
gttgtcagtacattactgcaggcaccagaattgccaactaagaccagaacatctaggaga
gctgctgaaaataaagacaccagcgagctgcttgacacttctcatctgaggagtcaggga
gaagatcttttggatcatgagcctgctgtttctccactgctcccaaggaaagaaagagtt
ccccaggacagtaatctgaacgaagatgaacgtcttctccccaaagacaagaaaaccaac
ctcttcagtgctcttatcaagaagaagaagaaaacagctccaaccccacccaaacgcagc
agttcttttcgggagatggatggccattcagaccgcagggcgggtggagaggatgaaacc
cgagatatcctcaatggcacttttatcacagctccctcagatgcagccgagtcatccaag
ttcccaagtccaagcaatgggttgaatgttagcaatggagcagtgtcagggtcctcaggc
ttccggtctccccacttgtggaaaaaatccattgcatcagcgagtagccgcctggcaacc
aatgaagaagaaagtagttccaactccagcaagcgtttcctgcggtcgtgctctgcctct
tgcgtaccccacggggccaaggacacagaatggaggtcagtaacactgcctcgggaccta
cagtccactggaaggcagtttgattcttctacctttggtgggcacaagagtgagaagcca
gctttgcctaggaaacgggcaagtgagaataaatctgatgtgacttctaggggcacagtg
accccgccaccccggctactgaagcaaaacgaggagggagttgacgatgtctttaaagat
acagagtccagtcctggttccagccccccaagtctgacaccaaaacttgtccgtaagcaa
gtcacagtgacagtttcctctggcttgtcccacaaagaagaaactgggaaaactagtgcc
ttaggagctcctgctgcactggaacaagtccctgttagcaaagctgcctccagtgcattt
atgggaaccagtaaggtctccagtgaagagcccagagggaggaggcacaaacattcttct
gaatcattagggaaggacaaaggaaagctttccagacttaaacctgcccctcctccccca
ccgtcatcatctgctgggaaatccaccaagccttctcatgacacagcgggggatgtagga
cctagtcttaaagcgaaacagttgactatggtagcagatgctgggaacagtgatgctgcc
aaatcaaaccagttaggagagggtgtcaaaaagccggcgctctcctctgcaccaaagccc
ccgtcatccaacaaaccatcagcggccccactaaccactccagccacctccccctctact
ttgccatctgcttcgtcagtcctgggaggggaacagctttcgtccactgctttcgtccct
ctcatatccacccgagtgtccctgcggaaaactcgccagcctccagagaggcttgctagc
ggtgctatcacaaaaggtgtggtcctagacagcaccgaggccttgtgcctggctatctcc
aaaaactcagaacagatggccagccatagtgctgtgctggaagcagggaaaaacctttac
actttctgtgtgagctacgtggactccatccagcagatgcggaacaagtttgctttcagg
gaggccatcaacaagttggaaaacaacctccgtgagcttcagatctgccccgcaacggcg
ggcagcggccctgctgccacccaggactttagcaagcttctcaactcagtgaaagaaatc
agcgatattgttcagagactgctgtga

DBGET integrated database retrieval system