KEGG   Sarcophilus harrisii (Tasmanian devil): 100930683Help
Entry
100930683         CDS       T02286                                 

Gene name
NUDT1
Definition
(RefSeq) 7,8-dihydro-8-oxoguanine triphosphatase
  KO
K17816  8-oxo-dGTP diphosphatase / 2-hydroxy-dATP diphosphatase [EC:3.6.1.55 3.6.1.56]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:shr03400]
    100930683 (NUDT1)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     100930683 (NUDT1)
    3.6.1.56  2-hydroxy-dATP diphosphatase
     100930683 (NUDT1)
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    100930683 (NUDT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-GeneID: 100930683
NCBI-ProteinID: XP_003761563
Ensembl: ENSSHAG00000016961
UniProt: G3WX39
LinkDB All DBs
Position
2
AA seq 156 aa AA seqDB search
MFTSRIYTLVLVMKPQQILLGMKKRGFGAGKWNGFGGKVEDGETIEEGAKRELLEESGLT
VDTLQKIGKITFEFVGNTELMDVHIFYADSFHGTPKESDEMRPQWFQLEQVPFSDMWPDD
SYWFPLMLQKKKFHGYFKFRGQNTILDYRLNEVEIV
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgttcacttctcggatttataccttagttttagtgatgaagcctcagcaaattctttta
ggaatgaagaaacgtggctttggagctggaaagtggaatggatttggggggaaagtagaa
gatggagagactattgaggaaggagccaagagggagctattggaggagagtggactgact
gtggacactctacagaagataggaaagatcacatttgaatttgtaggtaataccgagtta
atggatgttcacatcttttatgcggatagtttccatgggaccccaaaagaaagtgatgaa
atgcgcccccagtggttccagttggagcaagttccctttagtgacatgtggcccgatgac
agctattggtttccactaatgctccaaaagaagaaatttcatggatatttcaaattccgg
ggacaaaatacaattctagactacagactgaatgaagtggaaattgtctga

DBGET integrated database retrieval system