KEGG   Sarcophilus harrisii (Tasmanian devil): 100930830Help
Entry
100930830         CDS       T02286                                 

Gene name
TGM2
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:shr00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    100930830 (TGM2)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100930830 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core DWNN
Motif
Other DBs
NCBI-GeneID: 100930830
NCBI-ProteinID: XP_012409032
Ensembl: ENSSHAG00000018388
UniProt: G3X211
LinkDB All DBs
Position
1
AA seq 690 aa AA seqDB search
MASELIVEKSDLEFEKNGKNHWTSSMCQDKLVVRRGQPFNIVIYFQDRGFEASVDKLNFI
VETGPYPSEAAGTKAKFPLSDFVQEGVWAATVIGQENNVLYLTISSPPHAPIGYYKLLIE
TFTGSYNNIFSITGFILLFNPWCQADSVYVENDDFRKEYVLNQHGIIFQGSYKYVNKIPW
NFGQFEDGIIDICIELLDMNPKFFKDPRRDCCRRSSPIYISRVISAMVNCNDDKGILYGR
WDNYYMDGVSPMAWIGSVDILRKWKMSGCHPVKYGQCWVFAAVACTVMRCLGIPTRVVTN
YNSAHDSNSNLTIEVYRDERGEVLMNKSETVWNYHCWIEAWMARPDLKPEYNGWQAIDPT
PQEKSEGTYCCGPASIKAIKNGEVNTKYDAPFVFAEINADVVNWIKESDGDFKKLYTKTM
IVGVMISTKAIGKDEREDVTHHYKYPEGSEEERETYKRANHLNKLSLTNEHSLVEDVKIK
IKVSPNMSKGNDFDVFGVINNNSSEEQSCHLLMAARTVTYNGRLGPECAKTEQLSLAVEP
LSEKIIPLRICYSEYQKYLDESNLIKVKMLLQVLQSETFLMAERDIYLVNPEIKIRILGE
PKKLRKLVAELSLKNPLPVPLDNCIFTAEGAGLTPVQKIVHIPDPVEPGNIVTTRVDLMP
QWPGLHKLVVNFESDKMKGVKGYWNVIVGP
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgaattgatagttgaaaaaagtgacctggagtttgagaagaatggcaaaaat
cactggactagtagtatgtgccaggataaactggtggtcagacggggtcaaccattcaac
atcgttatatatttccaagacaggggctttgaggcttctgtggacaaattgaacttcatc
gtagagacagggccctatcccagtgaagctgcaggcaccaaggccaaattccccctctct
gactttgtccaggagggcgtctgggcagccactgtgattggccaagaaaacaatgtgctg
tacctgacaatctcctctccaccccatgctcccattggttactacaaactcttgatagag
accttcacaggatcctataataatatattctccatcactggctttatactgctcttcaat
ccctggtgccaagcggattcagtgtatgtagagaacgatgattttcggaaggaatatgtc
ctgaatcagcatggtatcatctttcaggggtcctataaatatgtcaacaagatcccatgg
aactttgggcagtttgaagatggcatcatagacatctgcattgagctcctggatatgaac
ccaaaattttttaaggatcctcgtcgtgactgttgccggcgcagcagccccatctacatt
agtcgggtcatcagtgccatggtcaactgtaatgatgacaaaggaatcttatatgggcgc
tgggataactactacatggatggagtcagccccatggcctggatagggagtgtggacatc
ctgaggaagtggaagatgagtggctgtcacccagtgaaatatggccaatgctgggttttt
gctgcagtggcttgcacagtaatgagatgccttggaatacccaccagggttgtaaccaat
tacaattcagcccatgattcaaactcgaacctgaccattgaagtgtacagagatgagaga
ggcgaggtactaatgaacaagagtgaaacagtatggaactatcactgttggattgaagct
tggatggcccgtcctgatctaaagccagagtacaatggttggcaagctattgatccaact
ccccaggaaaagagtgaaggcacatactgctgtggcccagcttcaatcaaagccatcaag
aatggtgaagtgaataccaagtacgatgctccctttgtctttgctgaaatcaatgcagat
gtggtaaactggatcaaagaaagtgatggggactttaaaaagctgtacaccaaaactatg
atagtaggcgtaatgatcagtacaaaggctataggcaaggatgagagagaagatgtcact
caccactacaagtatccagaagggtccgaggaggaaagggagacatataaaagagcaaat
catctgaacaagctgtctttaacaaatgagcactccctggtcgaagatgtgaagattaaa
atcaaagtgtccccgaacatgagcaagggtaatgactttgatgtctttggtgtgatcaac
aacaattcatcagaggagcaaagttgccatttgcttatggctgcccggacagtcacctac
aatggcagacttgggcctgagtgtgccaagacagagcagctctctctggctgtggaaccc
ctttctgagaagataatacctttgaggatctgctactcagaatatcagaagtacctggat
gagagcaaccttattaaagtgaaaatgctcctccaagtcctccagtccgagactttcctg
atggcggagcgagacatctacctggtgaatccagaaatcaagatcaggatcctaggagaa
cccaaaaagcttcgaaagctggtggctgaattgtcccttaaaaaccccctcccagttccc
ttggataattgtatctttactgcagaaggagcagggctgactccggtgcagaagatagtt
catatccctgacccagtggaacctggaaacattgtcacaacccgagtggacctgatgcct
caatggcctggactgcacaagctggtggtgaacttcgaaagtgacaaaatgaagggagtg
aagggctactggaatgtgattgttggaccatag

DBGET integrated database retrieval system