KEGG   Sarcophilus harrisii (Tasmanian devil): 100931000Help
Entry
100931000         CDS       T02286                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00040  Pentose and glucuronate interconversions
shr00051  Fructose and mannose metabolism
shr01100  Metabolic pathways
Module
shr_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100931000 (SORD)
   00051 Fructose and mannose metabolism
    100931000 (SORD)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     100931000 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 TrkA_N UDPG_MGDP_dh_N DUF2249
Motif
Other DBs
NCBI-GeneID: 100931000
NCBI-ProteinID: XP_023356762
Ensembl: ENSSHAG00000017314
LinkDB All DBs
Position
1
AA seq 366 aa AA seqDB search
CHPECCLPPTKRNGLVKTGSIEIERGLRTCEENYPIHEPGPNEVLLKMHSVGICGSDVHY
WKHGRIGDFVVKKPMVLGHEASGTVVQVGAMVKNLYPGDRVAIEPGVPRDIDEFCKIGRY
NLSPTIFFCATPPDDGNLCRFYNHNADFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVT
LGSEVLVCGAGPIGMVTLLVAKAMGASKVIVTDVNSSRLERAKECGATFTLLIDKESPKE
IVSKIDSLFGNKPHITIECTGVESSIQTSIYATRPGGTVVLIGLGKETVSIPLVHAAVRE
VDIRGVFRYCNTWPMAISMLASKLVNVKPLVTHRFPLEKALEAFETSSRGEGLKVMLKCD
PDDQNP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
tgtcatcctgaatgctgcttgcctcccacaaaaagaaatggtttagtgaaaacgggatcg
atagagattgagaggggactcagaacctgtgaggaaaactatccaattcatgaaccaggc
ccaaatgaggtgctgctgaaaatgcattcagttggaatctgcggctctgatgtccattac
tggaaacatggtcgaattggagactttgtggttaaaaagccaatggtgctgggacatgag
gcctcaggaactgtggtgcaggtgggagcgatggtaaagaacctttatccaggtgacagg
gttgccattgagccgggtgttccccgagacatcgatgagttttgtaagattggcaggtac
aatctgtctcccaccatctttttctgtgctacgcccccggatgatgggaacctctgcagg
ttttacaatcacaacgcggatttctgctacaaactccctgacaatgtcacctttgaggaa
ggggcccttatcgagccactctctgtggggatccatgcctgtcggagaggtggagtcact
ctgggaagcgaggtcttggtgtgtggagctggacccattggaatggtcactttgctggtt
gctaaagcaatgggtgcatctaaagtgatagtgactgatgtgaacagctctcgactagaa
agagccaaagaatgtggggccactttcaccctcctgatcgataaagagagccccaaggaa
attgtcagtaagatagacagtctctttggaaacaaaccacatatcaccattgagtgtact
ggagtggaatcttctatccagaccagcatctatgccactcgtcctggtgggactgtagtg
ctaataggattgggtaaggagacagtctctatccccctggtccatgcagctgtgcgagaa
gtggatatcagaggagtgtttcgatactgtaatacgtggcccatggcgatctcgatgctt
gcatccaagttggtgaatgtcaagcccttagtcacccacaggtttcctctggaaaaggcc
ctggaggcctttgaaacatccagtaggggagaaggattaaaagtcatgcttaaatgtgac
cctgacgaccagaatccctaa

DBGET integrated database retrieval system