KEGG   Sarcophilus harrisii (Tasmanian devil): 100931287Help
Entry
100931287         CDS       T02286                                 

Gene name
F13A1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:shr00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100931287 (F13A1)
Enzymes [BR:shr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100931287 (F13A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100931287
NCBI-ProteinID: XP_003760255
Ensembl: ENSSHAG00000014073
UniProt: G3WM90
LinkDB All DBs
Position
2
AA seq 727 aa AA seqDB search
MSQGTFSGRRALPPNNSNGEENELPTEEISGLLPRGVQLQEFLNVTDVHLFKDSWDTNKV
EHHTDRYYNEKLIVRRGQSFYIQIDFNRPYDPQRDIFRLEYVIGRYPQETKGTFIPVPIV
SEFQSGKWGAKIILKENRSVRLSVQSSPECIVGKFRMYIAVWTPYGIFRTKRNPETDTYI
LFNPWCEEDAVYLDNEKEREEYVLNDLGVIFHGNFDDVKTRSWNYGQFEDGILDACLYIM
DKAQMDLSGRKNPVKVSRVASAMINAKDDQGVIVGSWDNIYAYGVAPSAWTGSVDILLEY
QSSGNPVQYGQCWVFAGVLNTFFRCLGIPARIVTNFFSAHDNNANLQMDIFLDEDGKINP
KLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQVVDSTPQENSDGMYRCGPASVQAIKHGHV
CFQFDTPFVFAEVNSDLIYITVKKDTTHMVEAVDKTHIGKLVITKEIGGDGKQDITENYK
FPEGKEEERLALETALMYGAKKPLDTEGIHQFRADIDMDFEVEKAVLGKDFKVTITFRNS
TNRRYTATAYLSGNIVFYTGVAKSEFKNQTFDVKVEPYSFTNEEVQIKAGEYMGQLLEQA
SLHFFVSARINETSKVLAMQKSTVLHIPTVNLKVRGQKVVGSDMVVTVEFTNPLNETLYN
IWIHLDGPGVMKPTRKMFRELPPNSTLTWEEVCRPWVPGSRKLMATLNCDALRHVYGELD
LEIQRRR
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaaggaactttttccggcaggagggctctgccacccaacaattccaatggagaa
gagaatgagctccctacggaagagattagtggtctcttgcccaggggagttcaattacaa
gagtttctgaatgtcacagacgtccacctcttcaaagattcctgggataccaataaggtg
gagcatcacacagaccgatattacaatgaaaagctgattgttcgcagagggcaatccttc
tacatccagattgactttaatcgcccctatgatccccaaagggatatcttcagactggaa
tatgtcatcggtcgctaccctcaggaaactaaagggacattcattcctgttcccatcgtg
tcagagtttcaaagtggaaagtggggggcaaagataattttgaaagagaaccggtctgtc
cgcctctctgtccagtcctccccagagtgcattgtggggaaattccgcatgtatattgct
gtctggacaccctatggcatcttccgaacaaagagaaacccagaaactgacacttatatt
ctcttcaatccttggtgtgaagaagatgctgtgtatctggataatgagaaggaaagagaa
gaatatgttctgaatgaccttggggttattttccatggaaacttcgatgacgtaaaaact
agaagctggaactatggtcagtttgaagatggcatcctggatgcttgcctgtacataatg
gacaaagcacaaatggatctctctggacggaagaacccagtgaaagtcagtcgtgttgca
tcggcaatgatcaatgccaaagatgatcaaggtgttattgttggatcctgggacaatata
tatgcctatggggtggctccttctgcctggaccgggagtgttgatattctgttggaatat
caaagttctgggaatccagtacagtatggtcaatgctgggtttttgctggtgtcctcaac
actttttttcgttgccttggaatacctgcgagaattgtcaccaattttttctcagcccat
gataataatgctaatttacaaatggacatcttcctagacgaagatgggaaaataaacccc
aaacttacaaaggactcagtatggaactaccattgctggaatgaagcctggatgaccaga
cctgatcttcctgttggttttggaggatggcaagtggtggacagcacccctcaagaaaac
agtgatgggatgtatcgttgtggtcctgcctctgtccaggctattaagcatggccatgtc
tgcttccagttcgatacaccatttgtttttgcagaggtcaacagtgatcttatatatatt
acagtcaaaaaagataccactcatatggttgaagctgttgataaaacacacattgggaaa
ttagtcatcaccaaggaaattggtggagatggaaaacaggatataactgaaaattacaaa
ttcccagaaggcaaagaagaagaaagacttgctctagaaactgctctgatgtatggggct
aaaaagcctcttgacacagagggtatccatcaattcagagctgatattgacatggatttt
gaagtagaaaaagctgtacttggaaaagacttcaaagtcaccatcactttccggaacagc
accaacagacgttatacagctacagcttatctctctggcaatatcgtcttctacacaggt
gttgcaaagtcggaattcaagaatcagaccttcgatgtgaaagtggaaccctactccttt
acaaatgaggaggtgcaaatcaaagctggcgagtacatgggccagctgctggaacaagcc
tcgctccatttcttcgtctctgctcggatcaatgagaccagcaaggttctggccatgcag
aaatcaactgtactgcatattcctacagtgaacctcaaggttcgaggacaaaaagtggtt
ggttcagacatggttgttacagtagaattcaccaaccccctgaatgaaacactgtacaat
atctggatacaccttgatggacctggagtaatgaaaccaaccaggaaaatgtttcgtgaa
cttccacccaattctaccttgacatgggaagaagtgtgtcgcccctgggtccctggctca
cgaaaactgatggctaccctgaattgtgatgccttgagacacgtgtatggggaacttgat
ttagagattcaaagaaggcgatag

DBGET integrated database retrieval system