KEGG   Sarcophilus harrisii (Tasmanian devil): 100931480
Entry
100931480         CDS       T02286                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR isoform X1
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr04012  ErbB signaling pathway
shr04066  HIF-1 signaling pathway
shr04072  Phospholipase D signaling pathway
shr04136  Autophagy - other
shr04140  Autophagy - animal
shr04150  mTOR signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04152  AMPK signaling pathway
shr04211  Longevity regulating pathway
shr04213  Longevity regulating pathway - multiple species
shr04218  Cellular senescence
shr04371  Apelin signaling pathway
shr04613  Neutrophil extracellular trap formation
shr04630  JAK-STAT signaling pathway
shr04659  Th17 cell differentiation
shr04714  Thermogenesis
shr04910  Insulin signaling pathway
shr04919  Thyroid hormone signaling pathway
shr04920  Adipocytokine signaling pathway
shr04930  Type II diabetes mellitus
shr04931  Insulin resistance
shr04935  Growth hormone synthesis, secretion and action
shr05010  Alzheimer disease
shr05014  Amyotrophic lateral sclerosis
shr05016  Huntington disease
shr05017  Spinocerebellar ataxia
shr05022  Pathways of neurodegeneration - multiple diseases
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05168  Herpes simplex virus 1 infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05212  Pancreatic cancer
shr05214  Glioma
shr05215  Prostate cancer
shr05221  Acute myeloid leukemia
shr05224  Breast cancer
shr05225  Hepatocellular carcinoma
shr05226  Gastric cancer
shr05230  Central carbon metabolism in cancer
shr05231  Choline metabolism in cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100931480 (MTOR)
   04371 Apelin signaling pathway
    100931480 (MTOR)
   04630 JAK-STAT signaling pathway
    100931480 (MTOR)
   04066 HIF-1 signaling pathway
    100931480 (MTOR)
   04072 Phospholipase D signaling pathway
    100931480 (MTOR)
   04151 PI3K-Akt signaling pathway
    100931480 (MTOR)
   04152 AMPK signaling pathway
    100931480 (MTOR)
   04150 mTOR signaling pathway
    100931480 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100931480 (MTOR)
   04136 Autophagy - other
    100931480 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    100931480 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100931480 (MTOR)
   04659 Th17 cell differentiation
    100931480 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100931480 (MTOR)
   04920 Adipocytokine signaling pathway
    100931480 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    100931480 (MTOR)
   04919 Thyroid hormone signaling pathway
    100931480 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    100931480 (MTOR)
   04213 Longevity regulating pathway - multiple species
    100931480 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    100931480 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100931480 (MTOR)
   05206 MicroRNAs in cancer
    100931480 (MTOR)
   05205 Proteoglycans in cancer
    100931480 (MTOR)
   05230 Central carbon metabolism in cancer
    100931480 (MTOR)
   05231 Choline metabolism in cancer
    100931480 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100931480 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100931480 (MTOR)
   05212 Pancreatic cancer
    100931480 (MTOR)
   05225 Hepatocellular carcinoma
    100931480 (MTOR)
   05226 Gastric cancer
    100931480 (MTOR)
   05214 Glioma
    100931480 (MTOR)
   05221 Acute myeloid leukemia
    100931480 (MTOR)
   05215 Prostate cancer
    100931480 (MTOR)
   05224 Breast cancer
    100931480 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100931480 (MTOR)
   05168 Herpes simplex virus 1 infection
    100931480 (MTOR)
   05163 Human cytomegalovirus infection
    100931480 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100931480 (MTOR)
   05165 Human papillomavirus infection
    100931480 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100931480 (MTOR)
   05014 Amyotrophic lateral sclerosis
    100931480 (MTOR)
   05016 Huntington disease
    100931480 (MTOR)
   05017 Spinocerebellar ataxia
    100931480 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    100931480 (MTOR)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    100931480 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100931480 (MTOR)
   04931 Insulin resistance
    100931480 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100931480 (MTOR)
   01522 Endocrine resistance
    100931480 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100931480 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:shr04131]
    100931480 (MTOR)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100931480 (MTOR)
Protein kinases [BR:shr01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100931480 (MTOR)
Membrane trafficking [BR:shr04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100931480 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 Adaptin_N UME EPSP_synthase Nipped-B_C HEAT_EZ DUF4692
Other DBs
NCBI-GeneID: 100931480
NCBI-ProteinID: XP_031818727
LinkDB
Position
3
AA seq 2520 aa
MSGTVTILQQFASGLKSRSEETRAKTAKELQHYVTLELREMSQEESTRFYDQLNHHIFEL
VSSSDANERKGGILAIASLIGVEAYATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLAM
AGDTCTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDTIF
VAVWDPKQAIREGAVSALRACLILTTQREPKEMQKPQWYRHTYEEAEKGFDETLAKEKGM
NRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFGTKPRHITP
FTSFQAVQPQQSNALVGLLGYSAHQGIMGFGASPLPAKSTLVESRCCRDLMEEKFDQVCQ
WVLKCRSSKNSLIQMTILNLLPRLAAFQPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQ
ALGLLSVAVRSEFKVYLPRVLEIIRAALPPKDFAPKRQKAIQVDATVFTCISMLARAMGP
GIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHP
GMPKGLAHQLASPSLTSLPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEH
KEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCV
LASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLI
QILTELEHSGVGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPDPNPGVI
NNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYVV
EPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAV
SLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAI
TFIFKSLGLKCVQFLPQVMPTFLNVIRVCDAAIREFLFQQLGMLVSFVRSHIRPYMDEIV
TLMREFWVMNSSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRLFMHDSSPGRTVSIK
LLNAIQLFGANLDDYLHLLLPPIVKLFDAPDVPLAARKAALETVDRLTESLDFTDYASRI
IHPIVRTLDLSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDMLICR
IVKGYTLADEEEDPLIYQHRMMRSNQGDALASGPVETGPMKKLHVSTINLQKAWGAARRV
SKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQD
ELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAK
ALHYKELEFQKGPSPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLHE
WEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDEIQAKMARM
AAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAEL
TAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQR
ILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHPQ
VTYAYMKHMWKSARKIDAFQHMQHFVQTAQQQAQHAIAAEDQQRKHELHKLMARCFLKLG
EWQLNLQGINESTIPKVLQYYSASTEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKK
KLRHASGASVTSAHTEGSNSESEAESADNSPVPSPVQKKVTEDLSKTLLMYTVPAVQGFF
RSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTP
RPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQA
MMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETS
FNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPK
LLMCRDLELAVPGTYDPNQPVIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKGH
EDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHAL
IRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSPS
SEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTRE
KFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLNW
RLMDTNTKGTKRSRTRTDSYSAGQSVELLDSVDLGETTHKKTGTTVPESIHSFIGDGLVK
PEALNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7563 nt   +upstreamnt  +downstreamnt
atgtcgggcaccgtgaccatcctccagcagtttgccagtggcttgaagagccgcagcgag
gagacgcgggccaaaactgccaaggagctgcagcattatgtcaccctggaactccgggag
atgagtcaggaggagtctacccggttctatgatcagttgaatcatcacatttttgaactg
gtgtccagctcagatgccaatgagcggaaagggggcatcctggccatagccagccttata
ggagtggaagcatatgctacccgcataggcaggtttgctaactaccttcggaacctcctt
ccctccaatgacccagttgtcatggagatggcatccaaggccatcggccgcctggccatg
gcgggagacacttgcacagctgagtatgtggagtttgaggtgaaacgggccctcgaatgg
ctgggtgccgaccgcaacgagggccggagacatgcagctgttcttgtccttcgtgagctg
gccatcagcgtccccaccttcttcttccagcaagtgcagcctttctttgatactatcttt
gtggcagtctgggaccccaaacaggccatccgggaaggagctgtctctgccctccgagcc
tgtctgatcctcaccacccagcgtgaaccgaaagagatgcagaaaccccagtggtacagg
cacacctatgaagaagcagagaagggctttgacgagacactggccaaggagaaaggcatg
aatcgggacgaccggattcatggggccttgctgattctcaatgagcttgtgaggatcagc
agcatggagggagagcgtctccgggaagaaatggaagaaataacccagcagcagctagtg
catgacaagtactgcaaagacctcatgggctttgggacaaaacctcgtcacatcactccc
ttcaccagcttccaggcagtgcagccccagcagtccaatgccctggtcggcctgctgggt
tacagtgcccaccaaggcattatgggatttggggcgtctcccctcccagccaaatccacc
ttggtggaaagccgatgttgcagagacctgatggaagagaaatttgatcaggtgtgccag
tgggtgctaaaatgccggagcagcaagaactccctcatccagatgaccatccttaatctg
ttgccccgcctggctgcgtttcagccatctgccttcactgatactcagtacctccaggac
accatgaaccatgttcttagttgcgtcaagaaggagaaggaacgcacagctgcttttcag
gccctcggcttgctctctgtggccgtgagatccgagtttaaggtctatttgcctcgtgtt
ctggagatcatccgagcagccctcccacccaaggactttgctcctaagaggcagaaggcc
attcaggtggatgccacagtcttcacctgtatcagcatgctggcccgagccatggggccc
ggcatccagcaggacatcaaggagctcctcgagcctatgctggctgtgggcctgagccct
gccctgactgctgtgctctatgacctgagccggcaaattccacagctgaagaaagacatc
caggatggcctgctcaagatgctgtccctggtgctcatgcacaaacccctccggcacccc
gggatgcccaagggcctggcccaccagttggcctcccctagcctcaccagccttccagag
gccagcgacgtagggagcatcactcttgccctgcgaacccttggtagctttgaatttgaa
ggccactctctgacccagtttgtccgccactgtgccgaccattttctgaacagcgagcac
aaggagatccgcatggaggctgcccgcacctgctcccgcctgctcacgccctccatccac
ctcatcagcggccacgcccacgtggtcagtcagacggctgtgcaggtggtagcggatgtg
ctcagcaaactgctggtggttggaataacggacccagaccctgacatccgttactgtgtc
ctggcctccctggatgagcgctttgatgctcacttggcccaggcagagaacctgcaagcc
ttgtttgtggccctgaatgaccaggtgtttgagatccgggagctggccatctgcaccgtg
ggccgcctcagcagcatgaaccctgcttttgtcatgcctttcctgaggaagatgctcatt
cagattttgaccgagctggaacacagtggagttggaagaatcaaggagcagagtgcccga
atgctggggcacttggtttccaatgccccccggcttattcgtccctacatggagcccatt
ctgaaggctttaattctgaagctgaaagatccagaccctgacccaaacccaggggtgatc
aataatgtcttggctacgataggagaactggcacaggtgagtggcctggaaatgcggaag
tgggtggatgagctctttatcatcatcatggacatgctgcaggactcttctcttctggcc
aagaggcaggtggccctgtggaccctggggcaactggtggccagcacaggctatgtggtg
gagccctatcggaaatacccaaccttattggaagtgctgctgaactttctgaagactgag
cagaaccagggtacccggagggaggctatccgagttttggggcttttgggtgctttagat
ccctacaagcacaaagtcaacatcggtatgattgatcagtctcgggatgcttctgccgtc
agtttatctgagtccaagtccagccaggattcctccgactacagcaccagtgagatgctg
gtcaacatggggaacctgcctcttgatgagttctacccagccgtgtcgatggtggctctg
atgaggatcttccgtgaccaatccctctcccaccatcacaccatggtcgttcaggccatc
actttcatctttaaatccctggggctcaagtgcgtccagttcctgccccaggttatgccc
acgttcctcaacgtgatccgagtctgtgatgctgccattcgggaatttctgttccagcag
ctggggatgctagtgtcctttgtgaggagtcacatcaggccttacatggacgagatcgtc
accctcatgagagagttctgggtcatgaacagctccatccagagcacgatcatcctcctt
attgagcagattgtggtcgctctgggtggtgaattcaagctctacttgccccagctgatt
cctcacatgctgcggctcttcatgcatgacagcagccctggacgcacggtctccatcaag
ttgttgaacgcaattcagctgtttggcgccaatctggatgactacctgcatttgctcttg
cctccgattgtgaagctctttgatgctcctgatgttccattagcagcacgcaaggcagcc
ttggagactgttgatcgcttgaccgaatctctggatttcactgattacgcatcccgaatc
atccaccccattgtgcggacactggacctgagcccagagctgcgctccacagccatggac
acattgtcttctcttgtgttccagctggggaagaagtaccagatttttatcccaatggtg
aataaagtgctggtgagacacagaatcaaccatcagcgctacgacatgctcatttgtagg
atcgtcaagggctatacactagctgatgaggaagaagatcccttaatttatcagcaccga
atgatgaggagcaaccagggcgacgccttggccagtgggccggtcgagacagggcccatg
aagaagctgcatgtgagcaccatcaacctgcagaaggcctggggagcagccaggagggtt
tccaaggatgattggctggagtggctgagacggctgagcttggaattgctgaaggactcc
tcatctccgtccctccgctcctgctgggccttggctcaggcctacaaccctatggcgagg
gatctttttaatgctgcttttgtgtcttgctggtccgagctgaacgaagaccagcaggat
gagctcatcagaagcattgaactggccctgacatcccaggacattgctgaagtcacacag
accctgctcaacttggcagagttcatggagcacagtgacaagggtccgctgcctctccga
gatgacaatggcatcgtgctgctgggtgagcgagcggccaagtgccgcgcctatgccaaa
gcgttacactacaaggagctggagttccagaagggccccagccccgccatcctcgagtct
ctcatcagcatcaacaacaagctgcaacagccagaggcagcagctggggtgctggagtac
gccatgaaacactttggagagctggagatccaggctacctggtatgaaaagcttcacgaa
tgggaagatgctctggtcgcttatgacaaaaagatggacacaaacaaagatgaccctgag
ttaatgctgggccggatgcgctgcctggaggccttgggagaatgggggcagctccatcag
cagtgctgtgaaaagtggaccctggtcaacgatgagatacaagctaaaatggcccgcatg
gctgctgcagctgcttggggtttaggtcaatgggacagcatggaggagtatacctgtatg
atccctcgggacacccatgatggggctttttacagagccgtgctggccctgcatcaggac
ctcttctcattggctcaacagtgcatcgacaaagccagggacctgctggatgctgagcta
acggccatggcgggagaaagctacagccgagcctatggggcaatggtttcctgtcatatg
ctctcggagctggaggaagttatccagtataaacttgtccccgaacggcgcgagatcatc
cgccagatctggtgggagaggctgcagggctgccagcggattgttgaagattggcagaga
atcctcatggtgcggtctctcgttgtcaacccccatgaagatatgagaacttggcttaaa
tatgcaagtttatgtggcaagagtggaagattggcacttgctcataaaactttagtattg
ctcctgggagttgacccttctcgacaactagaccatccactgccgactgtccatcctcag
gtgacttatgcctacatgaagcacatgtggaagagtgcacgaaagattgatgccttccag
cacatgcagcactttgtgcagactgcccagcaacaggcgcagcacgccatcgctgccgag
gaccagcagcgcaagcacgagctccacaagctcatggcccggtgcttcttgaagctgggt
gaatggcagctgaatctccaaggcatcaacgagagcaccatccccaaggtcttgcagtac
tacagtgcttccacggagcacgaccgcagctggtacaaggcctggcacgcctgggcggtc
atgaactttgaagccgtgctgcactacaagcaccagaatcaggcccgagacgagaagaaa
aagctccgtcatgccagtggggccagtgtcacaagtgcccacacagagggcagcaacagc
gagagtgaggcagagagcgccgacaacagccctgtgccctcacctgtgcagaaaaaggtc
accgaggatctgtccaagacgctcctgatgtacacagtgcctgcagtgcagggcttcttc
cgctccatctctctgtcccggggcaacaaccttcaggacaccctcagagtcctcaccttg
tggtttgactacggacactggccagacgtaaatgaagctcttgtggaaggggtgaaggca
atccagattgatacgtggttgcaggtcatcccacagctcattgcaagaatcgacactccg
cggcccttggtgggacgccttattcatcagctgctcacagacatcggtcgctaccatccc
caggctctgatttaccccctaactgtggcctccaagtccactaccacggcccgccacaat
gcagccaacaagatcctgaagaacatgtgtgagcacagcaacaccctggtccagcaggcc
atgatggtgagcgaagagctgatccgtgtggccatcctgtggcacgagatgtggcacgag
ggtctggaggaagcttctcgtttgtacttcggggagaggaacgtgaaagggatgttcgag
gtgcttgaacccctgcatgcaatgatggagcggggtccccagactctgaaggaaacctcc
tttaatcaggcgtatggccgagatttaatggaggcccaagaatggtgtcggaagtacatg
aagtcagggaatgtcaaggacctgacccaggcgtgggacctctattatcacgtgttccga
cggatctccaagcaactgcctcagctcacttccctggagctgcagtacgtctcccccaag
ctcctgatgtgccgggacctggaactggcggtgccaggcacctacgaccccaaccagccg
gtcatccggattcagtctatagcgccctctctccaggtcattacatccaagcagaggccc
aggaagctgacgttaatgggcagcaacgggcacgagttcgtgttcctgctgaagggccac
gaggacctaaggcaggatgaaagagtcatgcagctcttcggcctcgtcaacaccctgctg
gccaatgaccccacctcccttcggaaaaacctcagcatccagagatacgccgtcattccc
ttatccaccaactcgggcctgatcggctgggtcccccactgcgacacgctgcacgccctc
atccgggactaccgggagaagaagaagatccttctcaacatcgagcatcggatcatgcta
cggatggctccggactatgaccacttgactctgatgcagaaggtggaagtgtttgagcac
gcagtcaacaacactgccggggacgacctggccaaactgctctggctgaagagccccagc
tccgaggtgtggtttgaccgaagaaccaactatacccgctctttagctgtcatgtcaatg
gttgggtacattttgggcctgggagacagacacccatccaacctgatgctggacaggctc
agtgggaagatcttacacatcgactttggggattgctttgaggtggcaatgactcgagag
aagttccctgagaagattccatttagattgacaaggatgctgaccaatgcaatggaggtg
accggcctcgacggcaactaccggatcacctgccacacagtgatggaagttcttcgggaa
cacaaggacagtgtgatggccgtgttggaagcctttgtgtatgatcccttattgaactgg
aggcttatggacacaaatacgaaaggcactaagcgatcacgaacgcggacagactcctac
tcagctggccagtctgtagaattactggacagcgtggatcttggggagaccacccataag
aaaacggggaccacagtgcccgagtccatccattcttttatcggggatggtttggtgaaa
cccgaggccctcaataagaaggcaattcagattattaacagggttcgagataagctcaca
ggtcgagatttttctcatgatgaaactttggacgttcctacacaagttgagctactgatc
aagcaggccacgtcccacgagaacctctgccagtgctacatcggctggtgtcctttctgg
taa

DBGET integrated database retrieval system