KEGG   Sarcophilus harrisii (Tasmanian devil): 100931562
Entry
100931562         CDS       T02286                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01524  Platinum drug resistance
shr03430  Mismatch repair
shr03460  Fanconi anemia pathway
shr05200  Pathways in cancer
shr05210  Colorectal cancer
shr05213  Endometrial cancer
shr05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100931562 (MLH1)
   03460 Fanconi anemia pathway
    100931562 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100931562 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100931562 (MLH1)
   05226 Gastric cancer
    100931562 (MLH1)
   05213 Endometrial cancer
    100931562 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100931562 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:shr03400]
    100931562 (MLH1)
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     100931562 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 100931562
NCBI-ProteinID: XP_031808368
LinkDB
Position
1
AA seq 740 aa
MSLVAGVIRRLDEKVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVTVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTVTTKTS
EAKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPSEEYGKILEVV
GRYSIHNSGVSFSVKKQGETTPDIRTLPNASVVDNIRSIFGNPVSRELLEVGCEDPVLGF
KMKGYISNANYSVKKCIFLLFINHRLVESTALKKAVESVYAAYLPKNTHPFLYLSLEIAP
QNVDVNVHPTKHEVHFLHEDSILERVQQHVEGRLLGANSSRTYFTQTLLPSIAGSVTEGL
KPASGGSASTQGAGDKVYAQHMVRTDSREQKLDAFLQPKSRPSAGQPPARSPERRPEAPA
GRPGEEMEEMEMEEAPKGPEPAADLRERDGPPAISTHRKRPREDSDVEPMEEEMTAACCP
RRRVVKLTSVLTLQEEISERGHEALQEMLRNHSFVGCVTPQWALAQYQTKLYLLDTTKLS
EELFYQILIYDFANFGVLRLSEPAPLYDLAMLALEHPESGWTEEDGPKEGLAEYIVEFLK
KKAEMLADYFSLEIDEEGNVTGLPLLIDNYIPPLEGLPMFVLRLATEVNWDEEKECFQSL
SKECAMFYSIRKQYVGEEASLSDPEKEEGSAAAGSWKWTVEHVLYKAFRSHLLPPRRFSE
DGSVLQLANLPDLYKVFERC
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgtctctggtggccggggtgattaggcgcctggacgaaaaagtcgtgaaccgcatcgcg
gccggggaggtcatccagcgccccgcaaacgccatcaaggagatgattgagaactgcttg
gatgccaaatccacaagtatccaagtgactgttaaagaaggaggcttgaagctgattcag
attcaggacaatgggactggaatccggaaagaagacctggacattgtgtgtgagaggttc
actacgagtaaactgcagtcatttgaagatctggcctccatttctacctatggctttcgg
ggggaggccttggccagtataagccacgtggctcatgtgactgtgaccacgaagacgtcg
gaggccaagtgcgcctacagagcaagctactcggatggaaaactcaaagcgcctcctaag
ccatgtgcggggaaccaggggacccagatcacggtggaagaccttttttacaacattgct
acgaggaggaaagctttaaagaatcccagtgaagagtatgggaaaatcttagaagttgtt
ggcaggtattctatacacaactcaggcgtcagtttctcagttaaaaaacaaggggaaacg
acgcccgacattcggacccttccgaatgccagcgtggtggacaatatccgatccatcttt
gggaacccagtcagcagagaactgctcgaggtgggctgtgaggaccccgtccttggcttc
aaaatgaagggctacatctccaatgccaactactcggtgaagaagtgcatcttcttactc
ttcatcaaccaccgactagtcgaatccaccgcattgaagaaggccgtggagagcgtgtac
gcggcctacctgcctaagaacacacacccgtttctttacctgagcctggagatcgccccc
cagaacgtagacgtcaacgttcaccccaccaagcacgaggtgcacttcctgcatgaggac
agcatcctggagcgcgtgcagcagcacgtggagggccgactcctgggcgcaaactcctcg
cgcacctacttcacgcagaccctgcttccgagcatcgccggctccgtgaccgaggggctg
aaacccgcctcggggggctcggcctcgactcagggcgccggcgacaaggtctacgcccag
cacatggttcgcaccgactctcgcgagcagaagctcgatgcttttctgcagcccaagagc
agaccctcagccgggcaacccccagcccggagtcctgagcggcggccggaggccccggct
ggccggcctggggaggaaatggaggagatggagatggaggaggcacccaagggccctgag
ccggcagcagatctgagggaaagggacgggccaccggctatcagcacccaccggaaacgg
ccgagggaagactctgacgtcgagccgatggaggaggaaatgaccgccgcctgctgcccg
aggagaagggtggtcaagctgaccagtgtgctgaccctccaggaggagatcagtgagaga
ggccatgaagctctgcaggagatgctgcgcaatcactcctttgtgggctgtgtgacccct
cagtgggccctggcccagtaccagaccaagctttaccttctggacaccaccaagctcagt
gaagaactcttctaccagattctcatctatgacttcgccaactttggggtgctgaggctg
tcggagcccgcgcccctgtacgacctggccatgctggccctggagcaccccgagagcggc
tggaccgaggaggacggccccaaggaggggctcgccgagtacatcgtggagttcctgaag
aagaaggccgagatgctcgccgactacttctccctggaaatcgatgaggaaggaaacgtg
accggattgcctcttctgattgacaactacatccccccattagaggggctccccatgttc
gtcctgcggttggctactgaggtcaactgggacgaggagaaggagtgctttcagagcctc
agtaaggagtgtgccatgttttactccatcaggaagcagtacgtgggggaggaggcgtct
ctctctgacccagagaaggaagaaggctcggccgctgctgggtcctggaagtggacggtg
gagcacgtgctctacaaggccttccgctcgcacctcctccctccccggcgcttctccgag
gacggcagcgtcctgcagcttgccaacctgcccgacctctacaaagtgtttgagcgctgc
taa

DBGET integrated database retrieval system