KEGG   Sarcophilus harrisii (Tasmanian devil): 100931646Help
Entry
100931646         CDS       T02286                                 

Gene name
SETD2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100931646 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shr03036]
    100931646 (SETD2)
Enzymes [BR:shr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100931646 (SETD2)
Chromosome and associated proteins [BR:shr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100931646 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 100931646
NCBI-ProteinID: XP_023353760
Ensembl: ENSSHAG00000010781
LinkDB All DBs
Position
2
AA seq 2551 aa AA seqDB search
MGFIKGPMFKGVASSRFLPKGTKTKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNDKQ
NDTPNSPAVPLQADFVPKIKMDPADTSTVAEESSPPKPKVELGKIHFKKHLLHVTSKPLL
NAVTPVAASPSLSIIPSPVVTESVVAESPPQSPPPPPSALQVRTPSPPAPISVTTALPQI
PTSVPVGTSLQSLPIDVAIRASKESLNIVVPESLELDTKQDTCSSELLDIVSQNVSEKVD
ISPQKEDSHIGKEEETPDSSKSSLCSKKTSSKKKFSQSEGMFLGSESDEDSVQTSSSQRS
HDFKNSASMEKERDSKKSLVTLKGEDLGKPSRSKTERDDKHFSYSKLDRDSRYMSSRSRS
ERERRRSRSRSRSERGSRTSSSYSRSERSHYYESERRYHRSSPYRERPRYSRSYADNRMR
ESSDSEEEYKKIYSRSSDSRRTSSHSSFYRDSRTSTYSKSDRDSKIESFHMDTEKRGKYS
SKPERESKRTSENELMKRCCSPPNEMGCRRGASYSKHDTNASRNKSVPWKSTQKPDKIKS
SFCCTESTEEIKHQSHSLNLQTCSKSNEFKMVKIPERDKTLCPSSTNRLNDSPTFKKLGE
SPIFKSEFMGNDSHDSIKESDTLSKGKHDQLRTYCPMELDINGSPGEGSDLATFCVSKTE
DIFTSSDDSINKSEVSPLIKTNKSCVLPSNGFQNVNRSKEKNLDDSFVHHSELNSSLKEM
DPSVPSQQDKFGSFPVINVDYSKTVKESVDLRVSYCKTKDLGSCNNLDDNSPCLYQLETE
TIEPAVIKVIPNTLMNQDSEVQSVICDNKNYKTLHSVQPTTEESEQKVRVKSVSVNPCDS
NSPVESSSVASVCSPTLGVKVDNPPVIQHTEGNLPLGVDTVLQNQSTEFLKHPGREIIEL
DEQQINPETRKRIVPWKNRHNSVLPMESLQAEEVEEVEDVMFHSGRERAVSTEGPFNKQE
GSRNMFYSGVSEPLFSSCEMSRTVEEGGGSIARGPKCDSSGNTSEFVSPNHGDYSDSSQS
TSDESDTEDTDSDDSSIPRNRLQSVVVVPKNSTLPMEETSPCSSQSSQVNRHYSDHWEDD
RPESSKPYEERFEGMMSKNCSQTEKFSFSKGADKSPDLPYMEPSRKHMEDLELEGAQPQS
DGVDSTSQADVASDRIGLKNLEERNVSKESLIITKPILRQQEEVPAYSSDGFEGILTKSR
QQNNFPNRPDSRLGKTESDNFSSSGDFSRVDGFHSAEDLGNLGWDFSQPEKPSTTYQQPD
SSYGIYTGYNYQQSTEQYRGTHNYWQGNGYWDPRLNRPSGMMYDRAQGHVPDSLTNDHEE
DEENWDDPRRHHFSNQSSKFLAHLHKEKGSVQAHEISSNSIKELSIVNEKKVPPKNLEKG
DVKDRGPPKKRRQELESDSESDSDMQDRKKVRMEVEQLETLPSGSALVGPLCVMDDFRDP
QRWKECARQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCECTPVSKDDRAQGEIACG
EDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVL
EYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCET
QKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSI
RAAGGKMKKERSRKKDSVDGELEALLENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKL
IQNTQSQSCLKSFLECHGLSLLWIWMAELGDGRGNNQKLQEEIIKTLEHLPIPTKNMLEE
SKVLPIIQRWSQIKTAIPQFSEGDGYSSENTSRAHTPLNTPDPSTKPNTEADTDTPKKLV
FRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENAPVEEDEESQPQQLQPQSLIPQH
LLPTKGDIETSLDSSKQPASEPEAEHEAEAKESNGPKLEESIAMETPSQDEEEGVSDVES
ERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENNGDRGRDNVSLRDQATT
PKTPNRSREREPERQTQSKEKKKRRSSLSPPPSAYERGTKRPDDRYDTPTSKKKVRLKDR
NKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYESLGYSAPHHSFVGYPPGYPM
QAYVDPSNPNAGKVLLPTPSMDPMCSPATYEHTQTLGHSVEPSLATPQPVPVVQHVATPM
EVSTSQYVAQNEAVVHQEPNVAVLPVPAPGPVQGQSYSVWDSNQQTVPVQQPYSPAQSQT
AIYYQGQTCQTVYGVTPPYSQTTPPIVQSYPQPGLQYIQGQQIFTAHPQGVVVQPAAAVT
TIVATGQPQSLQQPELVVTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVITR
QTQWDPPTWESPGDEANLEHEAEMDLGTPTYDENPMKSSKKPKTAEADTSSELAKKSKEV
FRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECN
ENVKHKTKEYIKKYMQKFGTVYKPKEDTDLE
NT seq 7656 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcatcaaaggtccaatgttcaaaggtgttgcatctagtcgatttctgcctaaa
ggcaccaagacaaaggtgaacctggaggagcaagggcgacagaaggtttcattcagcttc
agccttacaaagaaaactttgcaaaacaggtttctaacagcacttggaaatgataagcaa
aatgacactccaaattccccagctgttccccttcaagcagattttgttcccaaaatcaaa
atggaccctgcagatacttcaactgttgcagaagaatcttccccaccaaaaccaaaggtg
gaattgggcaaaatccattttaagaaacatttgcttcatgttacatctaagccactatta
aatgctgttacaccagtagcagcatcaccatctctttccataataccatcaccagtagta
acagaatcagtagtggcagagtcaccaccacagtcaccccctccaccaccctcagcccta
caagttagaacaccgtcaccaccagcaccaatatcagtaacaacagccttgccacaaata
ccaacatcagtaccagtggggacatcattacaatccctaccaatagatgtagcaattaga
gcctcaaaagagtctttaaatatagtagtaccagaatctttagaattggacactaagcaa
gatacatgttcttctgaactcttagatatagtatctcagaatgtatctgagaaagtagat
atatctccacaaaaagaagactcccatattgggaaggaagaagaaactccagatagttca
aagagttctctgtgttctaaaaaaacaagttctaagaagaaattctcacaatctgaaggc
atgtttcttggttcagaatcagatgaagattctgtacagacttcctcaagtcaacggtca
catgattttaagaattcagcaagtatggaaaaggaaagagattcaaaaaaaagcttagtt
accttaaaaggtgaagatttaggaaaaccttcaagatccaaaactgagagagatgataag
cattttagttactcaaaactagatcgagattctcgttatatgtcttcccgttctagatca
gagagagagagaaggcggagcaggtctcgctctagatctgagagaggatctagaactagt
tcttcctattctcggtcagagcgctcacattattatgagtctgaaagaagataccatagg
agctccccttatagagagaggccacgatattctcgttcttatgcagataataggatgaga
gagagctctgattcagaagaggaatataagaagatatattctaggtctagtgactcaaga
cgtacatcttcccattcttcattttacagagactcaaggacatctacttactctaaatct
gatcgggacagcaaaattgaatccttccacatggatacagagaaaagaggaaagtattcc
tcaaaaccagaaagagaatcaaaaaggacttcagaaaatgaattaatgaaaagatgttgc
tctcctcctaatgagatgggatgtcggagaggtgcatcttactctaaacatgatactaat
gcttcccgtaataaatctgttccatggaagagtacacaaaagcctgataaaattaaaagt
tctttctgttgtacagaatcaactgaggaaattaaacatcagtctcactctttaaattta
cagacttgttcaaaatctaatgaatttaaaatggtaaaaattcctgaaagagataaaact
ttatgtccttcttcaacaaatcgattaaatgattcaccaacttttaaaaagctaggtgaa
tctcctatttttaagtctgaatttatgggaaatgatagccatgatagtattaaggaatca
gacactttatctaaaggaaaacatgatcaattaagaacttattgtcccatggaattagat
ataaatggatctcctggggagggatctgatttagccactttctgtgtctctaaaactgag
gatatttttacgtcttcagatgatagtataaataaatcagaggtatctcctttgataaaa
actaataaatcatgcgtattaccatcaaatggatttcaaaatgtaaacaggtctaaagaa
aagaatttggatgattcttttgtacatcacagtgagttaaacagctcacttaaagaaatg
gatccttcagttccttcacaacaagataaatttggttcatttccagttataaatgtagat
tattctaaaacagttaaagaatcagttgatttgagagtttcttactgtaaaaccaaagat
ttgggttcttgtaataatttagatgacaatagcccttgtttgtatcaacttgaaactgaa
actattgagcctgcagttataaaggttatcccaaacacacttatgaaccaagattcagag
gtacagtctgtaatatgtgacaataaaaactacaagactcttcattcagtacagcccaca
actgaagaatctgagcaaaaggttagggtaaagtcagtgtctgttaacccttgtgactca
aattcacctgtagaaagttcaagtgttgcttctgtgtgtagtcctacattaggagtcaaa
gtagacaatccacctgtcatacaacacactgaggggaacttgcctcttggtgtggatact
gttctacaaaaccaaagcacagaatttctcaaacacccaggaagagaaataatagaattg
gatgaacagcaaataaatcctgaaacaagaaaaagaattgtaccttggaagaatagacat
aatagtgtactgcctatggagtctttgcaagcagaggaggtagaagaagtagaagatgtc
atgtttcacagtggaagagaaagagctgtctccacagaagggccatttaacaaacaggaa
ggaagtagaaacatgttttattctggtgtttctgagcctttgttttcatcttgtgaaatg
agtagaactgtagaagaaggaggaggtagtattgctcgtggccctaaatgtgatagcagt
ggtaatacatcagagtttgtttctcccaaccatggagattattctgattcttcacagagc
acaagtgatgaaagtgatacagaggatacagattctgatgacagcagtattccaaggaac
cgtctccaatctgttgttgttgtgccaaagaattctactttacccatggaagaaaccagt
ccttgttcatctcaaagcagccaagttaataggcactattctgaccattgggaagatgac
agaccagaatcaagtaaaccttatgaagaaagatttgagggaatgatgagcaaaaattgt
tctcagactgagaagttctcttttagcaaaggagcagataaaagtccagatcttccttat
atggagccaagcagaaaacacatggaggaccttgagctagaaggtgctcagcctcagagt
gatggagttgatagtacaagtcaagcagatgttgcatctgatagaattggtctgaaaaat
ctagaagaaagaaatgtgtctaaagagtcattaattataactaaacccatcctgaggcag
caagaggaggtaccagcttattcttctgatggttttgaaggtatccttacaaaatctcgg
caacagaataatttccctaataggcctgacagtagactaggaaaaacagagtcagataat
ttttcttcctcaggggatttctccagagtggatggtttccattcagcagaagacctcggt
aatctgggttgggacttctcccaaccagaaaaacccagtaccacttatcagcagcctgat
agcagctatggaatatatactggctacaactatcaacaaagtacagaacaataccgtggc
acacataattactggcaaggcaatggctattgggatccaagattgaataggccttctggg
atgatgtatgatagagcacagggacatgtaccagattccttaacaaatgaccatgaagaa
gatgaggaaaattgggatgatcctcgcagacatcatttttccaaccaatctagtaaattt
cttgcacatcttcataaggagaaaggctctgtgcaagcacatgaaataagtagcaattcc
attaaagagctttcaattgtaaatgaaaagaaagtccctccaaagaacctggaaaaaggt
gatgtgaaagatcgagggcctccaaagaaaagacggcaggaattagaaagtgactcggaa
agtgattctgatatgcaagacaggaaaaaagtgagaatggaggtagagcagttggaaaca
ttaccctcaggttcagcattggttggtccactgtgtgttatggatgacttcagggaccca
cagcgttggaaagaatgtgccaggcaggggaaaatgccttgttattttgacctaattgaa
gaaaatgtgtacttaacagaaagaaagaagaataaatcccatcgggatatcaagcgaatg
caatgtgagtgtacacctgtttctaaagatgatagagctcaaggagaaatagcatgtggg
gaagattgtctcaatcgtctcctcatgatagaatgttcttctcggtgtccaaatggagac
tattgttcaaatagacgattccagagaaaacagcatgcagatgtggaagtgatattaact
gaaaagaaaggctggggtctgagagctgccaaagatctcccgtcaaatacctttgtcttg
gaatactgtggcgaggtattagatcacaaagaatttaaagccagggtgaaggaatatgcc
cgtaacaagaacatccactattatttcatggcattgaagaatgatgagataatagatgct
actcagaaaggaaactgttctcgtttcatgaatcatagctgtgagccaaactgtgagaca
cagaagtggactgtgaatggacagctgagggttggcttttttaccactaaattggttcct
tcaggttcagagttaacatttgattatcagtttcaacgatatgggaaagaagctcaaaaa
tgtttctgtggctcagcaaactgccgaggttaccttggaggagaaaatagagtcagtatt
cgtgcagctggaggaaaaatgaagaaggagcgatctcgtaagaaggactctgtggatgga
gaacttgaagcacttctagaaaatggtgaaggtctttctgataaaaaccaggtgctcagt
ttatcaaggttaatggttagaattgagactttggagcaaaaacttacttgtctcaaactt
atacagaatactcagtctcagtcctgcttaaagtccttcttagaatgccatgggctctct
cttctgtggatttggatggcagagctaggtgatggtcgaggaaacaatcagaagctacag
gaagagattataaagaccttggaacatttgcctattcctacgaaaaatatgttggaggag
agcaaagtacttccaatcatccagcgctggtctcaaatcaagactgctatcccccagttc
agtgaaggtgatggttattccagtgagaatacatcacgtgcacacacaccactcaacaca
cctgatccttccaccaaaccgaatacagaagctgacacagatactccaaagaaacttgtg
tttcgtagacttaaaattataagtgaaaatagtatggacagtgcaatctctgatgctacc
agtgaactagaaggcaaggatggcaaagaagaccttgaccaattagaaaatgctcctgtg
gaagaagatgaagaatcacagccacaacaactgcaaccacagtcccttatcccacagcac
ttgctgccaacaaaaggtgacattgaaacttcactggacagcagtaaacagcctgcctca
gagccagaggctgagcatgaagccgaggccaaagagagtaatggcccaaagctagaagaa
tctattgctatggaaacaccttcccaagatgaagaggagggtgtatctgatgtagaaagt
gagaggagtcaagaacagccagataaaacagtggatataagtgatctggccactaagctt
ctagacagttggaaagatctaaaggaggtatatcgaattccaaaaaagagtcaaactgaa
aaagaaaacaatggtgatcggggaagggataatgtaagtctcagagaccaagcaactact
ccaaagactcctaaccgatccagagaaagagaaccagaaaggcaaacacagagcaaagaa
aaaaagaaacgaagaagttccctttcaccaccaccttctgcttatgaacgaggaacaaaa
agacctgatgatagatatgatacgcccacttctaagaaaaaagtgcgccttaaggaccgt
aataagctttctaccgaagagcgccggaagctctttgaacaggaggtagcccagcgggag
gctcagaaacagcagcagcagatgcagaaccttgggatgacttccccccttccttatgaa
tctttaggctatagtgctcctcaccatagctttgttggttaccctcctggttatcccatg
caggcttatgtggatcctagcaatcctaatgctgggaaggtgctattacccacacctagc
atggaccctatgtgttctcctgccacctatgaacatacccagactttgggacactcagta
gaaccaagccttgctactcctcaaccagttccagtagtgcaacatgtagcaacaccaatg
gaggtttcaacttcacagtacgtagcacagaatgaagccgttgttcatcaggaacctaat
gtggctgttttgccagtacctgccccaggtcctgtacagggacaaagttatagtgtttgg
gattctaatcaacaaactgtccctgtgcagcagccatattcacctgcacaatctcaaaca
gctatatattaccagggtcagacatgtcagactgtctacggtgtgacaccaccttattct
caaacgactccaccaattgtacagagttacccacaaccaggacttcaatacatccagggg
cagcagatatttacagctcacccacagggtgtagtagtacagccagcagcagcagtaact
acaatagtagcaacagggcagcctcaatccttacaacagccagagttagttgtgacaaat
aacctcctggatttgccaccaccttcacctcctaaaccaaaaaccatcgtcttgcctccc
aattggaaaacagcccgtgatccagaaggaaagatctactattaccatgtcatcacaagg
caaactcagtgggatcctcctacttgggaaagccctggagatgaagctaaccttgaacat
gaagctgaaatggacctgggaacaccaacttatgatgaaaaccccatgaagtcttccaaa
aaacccaaaactgcagaagcagatacctcaagtgaattggccaagaagagcaaagaagtg
ttcaggaaagagatgtcccagttcattgtgcagtgcctgaatccttaccggaaacctgac
tgcaaagtggggaggataaccacaacagaagacttcaagcatctagcacgcaagctgact
cacggtgtcatgaacaaggagctgaaatactgtaagaatcctgaagacctggagtgcaat
gagaatgtgaaacacaaaacaaaggagtacatcaaaaagtacatgcagaagtttgggact
gtttacaaacccaaagaagacacagacttggaataa

DBGET integrated database retrieval system