KEGG   Sarcophilus harrisii (Tasmanian devil): 100931806Help
Entry
100931806         CDS       T02286                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00020  Citrate cycle (TCA cycle)
shr00190  Oxidative phosphorylation
shr01100  Metabolic pathways
shr01200  Carbon metabolism
shr04714  Thermogenesis
shr04932  Non-alcoholic fatty liver disease (NAFLD)
shr05010  Alzheimer disease
shr05012  Parkinson disease
shr05016  Huntington disease
Module
shr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
shr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100931806 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100931806 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100931806 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    100931806 (SDHA)
   05012 Parkinson disease
    100931806 (SDHA)
   05016 Huntington disease
    100931806 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100931806 (SDHA)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100931806 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA FAD_binding_3 DAO Atg8 HI0933_like
Motif
Other DBs
NCBI-GeneID: 100931806
NCBI-ProteinID: XP_023351656
Ensembl: ENSSHAG00000018352
LinkDB All DBs
Position
2
AA seq 658 aa AA seqDB search
MPFELFNIFTFVFQQWPATLQSSTRKFHFTVSGEKKSSAKISNSISTEYPVVDHEFDAVV
VGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDT
VKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEEGKIYQRAFGGQSLKFGKGGQA
HRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCIEDGSIHR
IRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCL
ITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTVEIREGRGCGPEKDHVYL
QLHHLPPEQLASRLPGISETAMIFAGVDVNKEPIPVLPTVHYNMGGIPTNYKGQVLKHVN
GTDQIVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALSIAETCKPGDKVPQIKS
NAGEESVANLDKLRFASGNIRTSELRLNMQKSMQNHAAVFRVGSVLQEGCQKISQLYNDL
KDLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVRIDEYDY
SKPLEGQQKRPFAEHWRKHTLSYVDIKTGKVSLEYRPVIDKTLNEADCATVPPAIRSY
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgccttttgaactctttaatattttcacatttgtatttcagcaatggccagcaactttg
cagtctagcacacgaaaatttcactttactgtcagtggagaaaaaaagtcttcagctaag
atttcaaattcaatttccacagaatatcctgtagtagaccacgaatttgatgcagtggta
gtgggcgctggaggggcaggtttacgagctgcttttggactttctgaagctgggttcaat
acagcatgtgttacaaagcttttccccaccagatcacatactgttgcagcacagggagga
attaatgctgctttgggaaacatggaagaagacaactggagatggcatttctatgacact
gtaaaaggttctgattggttgggtgatcaggacgcaattcattacatgacagagcaagca
cctgcttcagtagttgagttggaaaattatggcatgccatttagtagaacagaagaagga
aagatttatcagcgagcatttggtggacagagcctaaaatttgggaaagggggacaagct
catcgatgctgttgtgtggcagacaggaccggccattctttattgcacactctgtatgga
aggtctctgaggtatgataccagttattttgtggaatattttgccttggatctcttaatg
gaagatggggagtgccgaggagtaattgcattgtgcatagaagatgggtccatacatcgt
ataagagcaaagaatacagttattgcaactgggggttatgggcgtacctatttcagctgt
acttctgctcatacaagcacaggagatggcacagctatggttacacgagcaggccttcct
tgtcaagacttggaattcgtacagttccatcccacaggcatatatggtgctggctgtctt
atcacagaaggatgtcgtggagaaggaggcattcttattaatagtcaaggtgaaagattt
atggaacgatatgcacctgttgcaaaggatttggcttccagggatgttgtatctcgttct
atgactgttgaaatccgtgaaggaagaggctgtggtcctgaaaaagaccatgtctatctg
cagttacaccacctacctcctgaacagttagcatctcgcctacctggaatatcagaaaca
gcaatgatatttgctggtgtggatgtcaacaaggaaccaattcctgtactccctactgtg
cattataacatgggaggcattcctacaaactataagggacaggttcttaaacatgtgaat
ggtacagatcaaattgtacctggtctttatgcttgtggtgaagcagcatctgcatcagta
catggtgctaatcgactaggagcaaactctcttctggatttggttgtctttggtcgtgct
tgtgccctcagtattgcagaaacatgcaaacctggtgataaagtccctcaaattaaatca
aatgctggggaagaatctgttgcaaatcttgacaaattaagatttgcttctggaaatata
agaacatcagaactgaggctcaacatgcaaaagtccatgcagaatcatgcagccgtgttc
cgtgtgggaagtgtgttgcaggaaggctgccagaaaataagccagctctacaatgactta
aaggatctgaagacatttgacagaggaatggtatggaatactgatttagtggagaccttg
gaattgcagaacctaatgttgtgtgctctgcaaactatttatggtgctgaggcccgtaaa
gaatcacgtggagctcatgcaagagaagactacaaggtaaggattgatgagtatgattat
tctaagccacttgaggggcaacaaaaaagaccatttgcagaacactggagaaagcacaca
ctttcttatgtggatatcaagactggaaaggtttctttggaatatagacctgtaattgac
aaaactttaaatgaagctgactgtgccacagttccgcctgctattcgctcttattaa

DBGET integrated database retrieval system