KEGG   Sarcophilus harrisii (Tasmanian devil): 100932157Help
Entry
100932157         CDS       T02286                                 

Gene name
OGDH
Definition
(RefSeq) 2-oxoglutarate dehydrogenase, mitochondrial isoform X1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00020  Citrate cycle (TCA cycle)
shr00310  Lysine degradation
shr00380  Tryptophan metabolism
shr01100  Metabolic pathways
shr01200  Carbon metabolism
Module
shr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
shr_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100932157 (OGDH)
  09105 Amino acid metabolism
   00310 Lysine degradation
    100932157 (OGDH)
   00380 Tryptophan metabolism
    100932157 (OGDH)
Enzymes [BR:shr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     100932157 (OGDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 100932157
NCBI-ProteinID: XP_003757785
Ensembl: ENSSHAG00000016718
UniProt: G3WW88
LinkDB All DBs
Position
1
AA seq 1020 aa AA seqDB search
MFHLRTCAAKLRPLTASQTVKTLSQNRPAAARTFQQIRCYGAPVAAEPFLSGTSSNYVEE
MYYAWLENPKSVHKSWDIFFRNANAGAPPGTAYQSPPPLSGALSALTQAQSLVHAQPNVD
KLVEDHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSSVPADIISSTDKLGFYGLDESD
LDKVFHLPTTTFIGGKESALPLREIIRRLEMAYCQHIGVEFMFINDLEQCQWIRRKFETP
GIMQFTNEEKRTLLARLVRSTRFEEFLQRKWSSEKRFGLEGCEVLIPALKTIIDKSSENG
VDYVIMGMPHRGRLNVLANVIRKELEQIFCQFDSKLEAADEGSGDVKYHLGMYHRRINRV
TDRNITLSLVANPSHLEAADPVVMGKTKAEQFYCGDTEGKKVMSILIHGDAAFAGQGIVY
ETFHLSDLPSYTTHGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPE
AVMYVCNVAAEWRSTFHKDVVVDLVCYRRNGHNEMDEPMFTQPLMYKQIRKQKPVLQKYA
ETLVSQGVVNQPEYEEEISKYDKICEEAFARSKDEKILHIKHWLDSPWPGFFTLDGQPRS
MSCPSTGLTEEVLTHIGNVASSVPVENFTIHGGLRRILKTRGEMVKNRTVDWALAEYMAF
GSLLKDGIHIRLSGQDVERGTFSHRHHVLHDQNVDKKICIPMNHLWPNQAPYTVCNSSLS
EYGVLGFELGFAMASPNALVLWEAQFGDFHNTAQCIIDQFICPGQAKWVRQNGIVLLLPH
GMEGMGPEHSSARPERFLQMCNDDPDVFPKLDDFDVRQLYDCNWIVVNCSTPANFFHVLR
RQILLPFRKPLIVFTPKSLLRHPEARSNFDDMLPGSSFQRVIPDNGPASQNPEKTKRLLF
CTGKVYYDLTRERQARNMEADVAITRIEQLSPFPFDLLQKEVLKYPNAELAWCQEEHKNQ
GYYDYVKPRLRTTIDRAKPVWYAGRDPAAAPATGNKKTHLTELQRLLDTAFNLDSFKGLF
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgtttcatttacggacttgtgctgctaaattgaggccattgacggcctcacagactgtt
aagacactttcacaaaacaggccagcagcagctaggacgtttcaacaaattaggtgctat
ggtgcacctgtggctgctgagccctttttgagtgggactagttcaaattatgtggaggaa
atgtactatgcttggttggaaaaccccaaaagtgtacataagtcatgggacatattcttt
cgaaatgccaatgctggagccccgcctggcactgcctaccaaagccccccacccctgagt
ggtgccttgtcagcactgacccaagcccaatccttggttcatgcccagccgaatgtagat
aagcttgtggaagaccatcttgcagttcagtctctcatcagggcatatcagattcgaggg
caccatgtagcacagctggatcccctgggaattttggatgctgatctggactcctccgtt
ccagctgatattatctcatccacagacaaacttgggttttatggattggacgaatcggac
ctcgacaaggttttccacttgcccactactactttcattggaggaaaggagtctgccctc
ccactccgagagatcattcgacggctagagatggcttattgccaacacattggagtggaa
ttcatgtttatcaatgacctggagcagtgccagtggatcagacggaaatttgagactcca
ggcatcatgcagtttacaaatgaggagaagcgtactctactagcaaggctggttcgctct
accaggtttgaagaattcttgcagcgaaaatggtcatctgagaaacgttttggcttagaa
ggttgtgaagtgttgataccggccctgaagactataattgacaagtcaagtgaaaatgga
gtggattatgtgatcatgggaatgccacacagagggcgcctgaatgtgcttgcaaatgtg
atcaggaaggaactggagcagattttctgtcaatttgattcaaaattggaggcggctgat
gagggttctggagatgtgaagtatcacttgggcatgtatcaccggaggattaaccgagta
acagacagaaacatcacgctgtccttggtggcaaatccttctcacctagaggctgctgat
ccagtggttatgggaaaaaccaaagctgaacaattttattgtggggatactgaaggcaag
aaggtgatgtccatccttatacatggagatgctgcatttgctgggcagggtattgtatat
gagacattccacttgagtgaccttccttcctatactacacatggcactgtgcacgtggta
gttaacaatcagattggctttaccacagaccctcgtatggcccgttcttctccataccct
actgatgtggcccgagtggtaaatgcaccaattttccatgtgaatgccgatgaccctgaa
gcagttatgtatgtgtgcaatgtggctgctgagtggagaagcacttttcataaggatgtg
gttgtggatttggtatgttacagacgtaatggtcacaacgaaatggatgagcctatgttc
actcagcccctcatgtacaaacaaatcagaaaacagaaacctgtgttgcagaaatatgct
gagaccctagtgtcacaaggagtggtaaatcagcctgaatatgaggaggagatttccaag
tatgataagatctgtgaggaggcctttgccagatctaaagatgagaagatcctacacatc
aagcattggcttgactcaccctggcctggtttttttactctagatggacagcccaggagt
atgtcttgtccttcaactggtctaactgaagaggttctgacacacataggaaatgtagcc
agctctgttcctgtagagaattttaccattcatgggggcttgagacgaattctaaaaacc
cgtggagaaatggtaaagaatcgaacagtggactgggcccttgctgaatacatggccttc
ggctcactcctgaaagatggaatccatattcggctcagtggccaggatgttgaacgggga
accttcagccatcgtcaccatgtgctacatgaccagaatgtagacaagaaaatctgcatt
cccatgaaccacctttggccaaaccaggctccatatacagtctgcaacagttctctgtct
gaatatggagtcttaggctttgagctaggctttgctatggcaagtcctaatgcccttgtc
ctttgggaggctcagtttggtgacttccacaacactgctcagtgcatcattgaccagttc
atttgcccaggacaggccaagtgggttcgacagaatggcattgtgttgctactcccccat
ggcatggaaggaatgggtccagagcattcatcagctagaccagagagatttctgcagatg
tgcaatgatgatccagatgtcttccctaaacttgatgactttgatgtgcgtcaactctat
gactgcaactggattgttgttaattgttccactcctgccaacttcttccatgtcctccga
cgacagatcttgctgcccttccggaagccgttgatcgtcttcactccaaagtcactgctg
cgtcaccctgaagccaggtccaactttgatgacatgcttccaggtagcagtttccagcgt
gttattccagacaatggtcctgcttcccagaacccagagaaaaccaagagacttcttttc
tgtaccggcaaggtgtactatgaccttactcgagagcgacaagccagaaacatggaggca
gatgtggctatcaccaggattgagcagctctccccgttccccttcgacctcctgcagaag
gaagtgctgaagtaccctaatgcagagctggcctggtgccaggaagagcataaaaatcag
ggttactatgactacgtgaagccaagacttcgcacgaccatagaccgagccaagcctgtc
tggtatgctgggcgtgaccctgctgctgccccagccacaggcaacaagaagacacacctg
acagagctgcagcgtctcctggatactgctttcaatctggactctttcaagggcttattc
tag

DBGET integrated database retrieval system