KEGG   Sarcophilus harrisii (Tasmanian devil): 100932537Help
Entry
100932537         CDS       T02286                                 

Gene name
ACE
Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04614  Renin-angiotensin system
shr04924  Renin secretion
shr05142  Chagas disease (American trypanosomiasis)
shr05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:shr00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100932537 (ACE)
   04614 Renin-angiotensin system
    100932537 (ACE)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100932537 (ACE)
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    100932537 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:shr01002]
    100932537 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:shr04147]
    100932537 (ACE)
   04090 CD Molecules [BR:shr04090]
    100932537 (ACE)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     100932537 (ACE)
Peptidases [BR:shr01002]
 Metallo Peptidases
  Family M2
   100932537 (ACE)
Exosome [BR:shr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100932537 (ACE)
CD molecules [BR:shr04090]
 Proteins
  100932537 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 100932537
NCBI-ProteinID: XP_012403926
Ensembl: ENSSHAG00000010621
LinkDB All DBs
Position
4
AA seq 1300 aa AA seqDB search
MVFPSRGCPGPLVRQVVSLLMLAGLLLPPAQALPNELLPGDFPADEKGAADFAKSYNSTA
ETVLYQSTLASWNYNVNISKENAKLQEEADLFSQEFTEAWGLKAKKLFDPIWKNFTDPLL
QKVINSIRILGSANLPLEQRQKYNTLLSKMTSIYSSAKVCFPNKTATCWALEPELTEIMA
SSRSYSKLLFAWEGWHNAVGIPLKPEYQSYVNLSNEASKMDGFKDTGEYWRSWYNSPTFT
EDLERLYQQLEPLYLNLHAFVRRGLHRRYGDKYINLRGPIPAHLLGNMWAQSWENIYDLV
VPFPNKPNLDVTNTMVQKGWNATHMFHVAEEFFTSLGLLPMPPEFWAKSMLEKPNDKREV
VCHASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKNQPVSLRAGANPGFH
EAIGDVLALSVSTPTHLNKIGLLDKVINDNENDINYLLKMALEKIAFLPFGYLVDQWRWR
VFSGVTTPSQYNSDWWYLRTRYQGICPPITRNETHFDAGAKYHVPAVTPYIRYFVSFVLQ
FQFHKALCAEAGYSGPLHYCDIYQSQKAGDKLREVLQAGASRSWQEILKGLTGTETLDAG
PLLEYFQPLISWLQQQNQNNGEVLGWPEFDWRPPVPDGYPEGIDKLTDEAEAEKFLEEYD
RLGQGIMNAYVEASWAYNTNITEENSKIMLEKNLELSSFTLQYGTRARQFDVSSFQKSSV
TRLLGKLQDLGRAALSPTELDKYNKILLNMESAYSTAKVCRQGGSCVPLEPDLTELMASS
QDYDNLLWAWKGWRDKAGRAILPHFSEYVELSNKAAQLNGYADSGASWRAQYEKPSLEQD
LEKIYLELQPLYQNLHAYVRRALFRHYGPNHINLQGPIPAHLLGNMWAQTWSNIYKLMVP
FPSASQVDATPAMKEQGWTVRRMFEEADKFFQSLGLLPLPPEFWNKSMLEKPNDSREVVC
HASAWDFYNGKDFRIKQCTTVNMEDLIVIHHEMGHVQYFMQYKDQPIAFREGANPGFHEA
IGDVLALSVSTPKHLHSIGLLDNEGEGYESEINYLMSVALDKIAFIPFGYLIDQWRWRVF
DGSINKKDYNQEWWSLRLKYQGLCPPVPRTQEDFDPGAKFHIPANVPYLRYFVSFVIQFQ
FHEALCRAAGHTGPLHKCDIYQSKEAGKLLSDAMKLGLSKPWPEAMMLLTGQPNMSATAI
VKYFQPLLDWLITKNKEQEETLGWPQYDWTPYGASRAPNSDKISFLGMELTSGQAKAGQW
TLLVLGLAFLMAIIGLAYKTYKLKRRQEPYFSSEVELRHS
NT seq 3903 nt NT seq  +upstreamnt  +downstreamnt
atggtcttcccatcccggggctgccccgggccgctcgtgcggcaagtcgtctcgctgctg
atgctggccggactgcttctgccgcccgcccaggccctgcccaacgagctgctgcccggg
gactttcccgcagatgagaaaggggctgcagacttcgccaagagctacaactctacagcg
gagaccgtcctgtaccagagcaccttagctagctggaattacaacgtcaacatcagcaaa
gagaacgcaaagctgcaggaggaagcagacctattttctcaagaattcactgaggcatgg
ggtctgaaagccaagaagttgtttgaccccatctggaagaacttcactgaccccctgctt
caaaaggtcataaattctattcggatcttgggctccgccaatctgcccctagagcagcgt
cagaagtacaataccttgctgagcaaaatgaccagcatatattcttcagccaaggtctgc
tttcccaacaagactgccacctgctgggccttggaaccagagcttacagaaatcatggcc
tcatcaaggagctacagtaagctgctgtttgcctgggagggctggcacaatgctgtaggg
attcctctgaaacctgaatatcaatcttatgtcaatctcagcaatgaggcttccaagatg
gatggctttaaggatacaggagaatactggcgttcttggtataattcacccacattcacg
gaagacctagaacgactgtaccaacagctggagccactctacctgaatctccatgctttt
gtacgccgtggcttgcaccgccgctatggagacaagtacatcaatctccgtggccccatt
cctgctcatcttctgggaaacatgtgggcacagagttgggaaaacatctatgacctggtg
gttcctttcccgaacaagcccaatctcgatgtcaccaacaccatggtgcagaagggctgg
aacgccacacacatgttccacgttgccgaagaattctttacgtccctggggctactgcct
atgcctccagagttctgggccaagtccatgctggagaagccgaatgataaacgagaggtg
gtatgccatgcctctgcctgggacttctacaacaggaaagattttaggattaagcagtgc
acaagagtgaccatggaccagctgtccactgtacatcatgagatgggccacatacagtat
taccttcagtacaaaaatcagcctgtttccctgcgagcaggtgccaaccctggtttccac
gaagccatcggggatgtgctagccttatcagtctccacacctactcatctaaacaaaatc
ggcctgttggacaaagttatcaatgacaatgaaaatgacatcaactacctgttgaagatg
gcactagaaaagattgccttcttgccctttggttacctggtggaccagtggcgttggagg
gtctttagtggggtcacaactccatctcagtacaactctgattggtggtaccttcggact
agataccagggcatctgccctcccataacccggaatgaaacccactttgacgctggagca
aagtatcatgtcccggctgtaacaccatacatcaggtattttgtgagctttgtcctgcag
ttccagttccacaaagctctgtgtgctgaggcgggctacagcgggcccctgcactactgt
gacatctaccaatctcaaaaggctggtgacaaactcagggaggtactgcaagcaggtgct
tctcggagctggcaggaaatacttaaggggctgacaggcacagagactctggatgcagga
ccacttcttgaatacttccagcctctcatcagttggctgcaacaacagaaccagaataat
ggcgaggtcctgggctggcctgaatttgactggcgtcctccagtgccagatggctatcca
gagggcattgacaagctgactgatgaagcagaggctgagaagttccttgaggaatatgac
cggttgggacaaggcataatgaatgcatacgtagaggccagctgggcttacaacacaaac
atcacggaggaaaatagcaagattatgttggaaaagaacctggaattatcttctttcacc
ctacaatatggcacccgtgcccgccagtttgacgtcagcagtttccagaaatcatcagtg
acacgactcctaggaaagcttcaagatttaggtcgggcagccctgtctccaacagagttg
gataagtacaataagatcctgttgaacatggagtcagcttacagtacagccaaagtgtgc
cggcaaggtggttcctgtgtacccctggagcctgatttgacggagttgatggcctcatcc
caggactatgacaacctgctatgggcatggaagggttggagggataaggcaggacgggct
attcttccccacttctcggagtatgtggaacttagcaacaaggctgcccagctcaatggc
tatgctgattctggagcttcctggagagcccagtatgaaaaaccttccctggagcaggat
ctggagaaaatctacctggaactgcagcccctctaccagaacctccatgcctacgtccgc
cgtgctctgttccgtcattatggacccaaccacatcaaccttcaggggcccattcctgct
catctattaggcaatatgtgggctcagacctggtccaatatctataaattgatggtaccg
ttcccttctgccagccaggtggatgctactccagctatgaaggaacagggctggactgtg
cggaggatgtttgaagaggcagataaattcttccagtcccttggcctgctgcccttgccc
cctgagttctggaataaatcaatgctggagaaaccaaatgatagccgagaagtggtgtgc
catgcttctgcctgggatttctacaatggcaaagacttcaggattaaacagtgcacaaca
gtgaatatggaggatctcatcgtcatccaccatgagatgggccatgtgcagtatttcatg
caatacaaagaccaacctatagccttccgagagggtgctaacccaggtttccatgaggct
atcggagatgtgctggcactctctgtctccacccccaagcacttacacagtattggtctg
ctggataatgagggcgagggctatgagagtgagatcaactatctgatgagtgtcgcactg
gacaagattgccttcattccttttgggtaccttattgaccaatggcgctggcgggtgttc
gatgggagcatcaacaagaaagattacaaccaggagtggtggagcctcaggctaaagtac
cagggtctctgtccaccagtgcctaggacacaagaagactttgacccaggcgccaagttt
cacatacctgcaaatgtgccctatctcagatactttgtcagttttgtgattcagttccag
ttccacgaggccctgtgccgagctgccggtcacacaggtccactgcacaagtgtgatatc
tatcaatcaaaggaggcagggaagctcttgtcggatgctatgaaactaggactcagtaag
ccctggccagaggctatgatgcttctgacgggacagcccaacatgtcagccacagctatt
gtgaaatacttccagcccctgctggactggctcatcaccaagaacaaggaacaggaagag
accctgggatggcctcagtatgactggactccatatggtgcctccagagcccccaacagt
gacaaaatcagcttcttgggaatggagctgacgtctgggcaggctaaagcagggcagtgg
accctgcttgttctgggcctggcgttccttatggctataataggcttggcctataaaaca
tataaactcaaaaggcgacaagagccttattttagctctgaggtggagctgagacactcc
tga

DBGET integrated database retrieval system