KEGG   Sarcophilus harrisii (Tasmanian devil): 100932636
Entry
100932636         CDS       T02286                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1 isoform X1
  KO
K02084  apoptotic protease-activating factor
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01524  Platinum drug resistance
shr04115  p53 signaling pathway
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr05010  Alzheimer disease
shr05012  Parkinson disease
shr05014  Amyotrophic lateral sclerosis
shr05016  Huntington disease
shr05020  Prion disease
shr05022  Pathways of neurodegeneration - multiple diseases
shr05134  Legionellosis
shr05152  Tuberculosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05164  Influenza A
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100932636 (APAF1)
   04215 Apoptosis - multiple species
    100932636 (APAF1)
   04115 p53 signaling pathway
    100932636 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100932636 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100932636 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100932636 (APAF1)
   05012 Parkinson disease
    100932636 (APAF1)
   05014 Amyotrophic lateral sclerosis
    100932636 (APAF1)
   05016 Huntington disease
    100932636 (APAF1)
   05020 Prion disease
    100932636 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100932636 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100932636 (APAF1)
   05152 Tuberculosis
    100932636 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100932636 (APAF1)
   05160 Hepatitis C
    100932636 (APAF1)
   05164 Influenza A
    100932636 (APAF1)
   05162 Measles
    100932636 (APAF1)
   05168 Herpes simplex virus 1 infection
    100932636 (APAF1)
   05169 Epstein-Barr virus infection
    100932636 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100932636 (APAF1)
SSDB
Motif
Pfam: WD40 NB-ARC APAF1_C ANAPC4_WD40 CARD Ge1_WD40 WD40_like Nup160 eIF2A CARD_2 AAA_16
Other DBs
NCBI-GeneID: 100932636
NCBI-ProteinID: XP_012406041
Ensembl: ENSSHAG00000011224
LinkDB
Position
5
AA seq 1251 aa
MDAKAWNCLLQHKEALERDIKTSYLMDHMISDRALSLSEEEKIRDQPTQKKRAAMLIRVL
LEKDNNSYISFYNALLHEGYKDLAFLLQDGIPLSSHNGKDSADGVTSYVKTVLCEGGVPQ
RPVVFVTRKKLVKSIQEKLYKLDGEPGWVTVYGMAGCGKSVLAAEAVRDHSLLQTCFPGG
VHWVSIGKQDKSGLLMKLQNLCTRLDQDGAFSQRLPLNLEEAKDRLHFLMLRKCPRSLLI
LDDIWDSWVLKAFDNHHQILLTSRDKSVTDSVMGPKYVVPVESGLRKEKGLEILSLFVNM
KKTDLPEQAHSIVRECKGSPLVVSLIGALLRDFPNRWGYYLRQLQNKQFKRIRKSSSYDY
EALDEAMSISVERLNEALQKYYKDLSILQKDVRVPTKVLCILWDMETEEVEDILQEFINK
SLLFYDRNGKSFHYYLHDLQVDFLMEKNRDQLQELHKKVVTQFQRYYKVHSLASDQEDSM
YWYNFLVYHMANANMRQELCDLLFSLDWIKAKTELVGPAHLIHEFMQYSHLLDKKDCTIR
ENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEIYRQAKLRAKQEVDKGRLYLEWINKK
NIKKLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVLKAETGERLLEIEAHEDDVL
CCAFSKDDRFIATCSVDKKVKIWNSRTGDLVHTYDEHTEQVNCCHFTNMEHHLLLATGSN
DYFLKLWDLNKKECRNTLFGHANSVNHCRFSPDDKYLVSCSADGTLKLWDVRSANEWSSI
DVRQHFLNSDGRQEDVEVMVKCCSWSSDGMRVMAAAANRLLVFDVHSRNLVGQIHTGYSS
TIRYCDFFPKSHLAVVALSHYCVELWNMDTGIKVADCRGHLSWVHCVAFSPDGSSFLTAS
DDETIRLWETKKVCKNSAVMLKQEVDVVFREDEVMILAIDNVRRLQLINGKTGHTDYLTE
AQKSRISCCCLSPDLRYVALGEEDGSVKILELPNGREFRSRMGHEKAVRRVQFTSDGRTL
ISSSDDSTVQVWNWHSEEFVFLKAHQEPVKDFRLLQNSQLLTWSFDGTVKVWNILTGKVE
KDFVCHQGTVLSCDISPDATKFSSASADKTAKIWSFESHSPLHELRGHEGCVRCSVFSGD
SALLATGDDNGEIRIWNVSTGQRLHSCVPVTVEKGETAFVGWVTDLRFSPDSRTLVSAGA
YLKWWNVDTGESLQTFYTNGTNLKTIHVSPSFKTYVTVDNLGILYVLQALE
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggatgccaaagcttggaactgtttgttacagcacaaggaagccctggaaagagacatc
aagacttcctacctcatggatcacatgatttctgatcgagctcttagtttatcagaggag
gagaaaataagagatcagcctacccaaaagaagagagcagctatgctgattagggtgtta
cttgaaaaagataataattcatacatatctttctacaatgctctgctacatgaaggttac
aaagatttggctttccttcttcaagacggtatccctcttagttcccataatggaaaagat
tcagcagatggggtgacttcatatgtgaaaacagtgttgtgtgaaggtggtgtaccgcag
aggcctgttgtgtttgtgaccaggaagaagctggtgaagtcgatccaggaaaagctttat
aagcttgatggtgaacctggatgggtcacagtctatggaatggcaggttgtgggaaatct
gtcctagctgcagaagctgtccgggaccacagtctcttacagacatgctttccaggaggt
gtgcattgggtctccattggcaaacaagacaaatctgggctcctgatgaaactccagaat
ctgtgcacaagactggaccaggatggtgctttttcccagagactcccattgaaccttgaa
gaagccaaagaccgccttcatttcttgatgctacgcaagtgcccaaggtctcttttgatc
ttggacgacatatgggattcgtgggtgctaaaagcttttgacaatcaccatcagatcctt
ctcaccagtagagataaaagtgtgaccgactcagtgatgggtcccaaatatgtagtccct
gtggagagtggcttaagaaaagagaaaggattggaaatcttgtcgctctttgttaatatg
aaaaaaacagatctgcccgaacaagctcatagcatcgtgagggagtgcaaaggttcccct
cttgtagtgtctttaattggtgccctattacgtgatttccccaatcggtggggatactac
ctcaggcaacttcagaacaagcagtttaaaagaattaggaagtcttcatcttatgactat
gaagccctggatgaagccatgtccataagtgtggaaagactgaatgaagccctccagaag
tattataaggacctttccatcctgcagaaggatgtaagagtacctactaaggtattatgt
attctttgggacatggagactgaagaagttgaagacatcctacaagaattcattaataaa
tccctcctgttttatgaccgaaatggaaaatcattccattattatttacatgatcttcag
gtcgatttcctcatggagaagaaccgtgaccagctccaggaattgcacaaaaaggttgtg
actcagttccagagatattataaggtgcactctcttgcttctgaccaagaagactccatg
tactggtacaactttctggtgtatcacatggcgaatgccaacatgcgccaagagctttgt
gatctattgttttccctggattggattaaagcaaagactgagcttgtgggacctgctcat
ctgatacatgagtttatgcaatatagccatctattggataagaaggattgcaccattcgt
gagaattttcaagaatttttatctctcaatggacaccttcttggacgccagccatttccc
aatattgtgcagctaggtctctgtgagcccgaaacttctgaaatatatcggcaagccaaa
ttacgagccaagcaggaggtcgacaaagggaggctttacttggaatggataaacaaaaaa
aacatcaagaaactctcccgtttagttgtccgcccccacacagatgctgtttaccacgcc
tgcttttcagaggatgggcagaggattgcttcctgtggtgctgataaaaccttacaggtc
ctgaaagcagaaacaggagagaggctcctggaaatcgaggctcacgaagatgatgtgctt
tgttgtgctttctccaaggatgatagattcatagcgacctgttcagtggataagaaagta
aagatttggaattcaaggactggagatctggtacacacctatgatgagcacaccgagcag
gtcaactgctgtcactttaccaatatggagcatcaccttctcttagccactggctccaat
gactacttcctcaaactctgggatctgaataagaaggagtgtcggaataccctgtttggt
catgcaaattctgtgaaccactgccgattctcaccggacgataaatatttggtcagctgc
tcagcagatggaacgttgaagctttgggatgtgcgttcagccaatgaatggagtagcatt
gatgtgaggcagcacttcttgaattctgatggacgtcaggaagatgtggaggtgatggtg
aaatgttgctcctggtccagcgatgggatgcgagtgatggcagctgctgccaacaggctc
ttggtttttgatgttcatagcaggaatctggtaggacaaatccatactggttatagcagc
accatccggtactgtgatttctttcccaagagtcaccttgctgtggtagccctgtcccac
tactgtgtggagttatggaatatggatacgggtataaaagttgcagattgtcgaggacac
ctgagttgggttcactgtgtagcattttctcctgatggatcttcatttttaacggcttct
gatgatgaaacaatcaggctctgggagacaaagaaagtatgtaagaattctgctgtcatg
ttaaagcaggaagtagatgttgtattccgagaggatgaagtgatgattcttgcaattgac
aacgtaagacgcctgcaactaattaatgggaaaacaggtcataccgattatctgactgaa
gcccagaaatctcgaattagctgctgttgtctgagtccagacctgcgctatgtggcatta
ggagaagaggatgggtctgtaaagattttagagctccccaatggaagagagtttcgatct
cgaatgggacatgagaaagctgtacgacgtgtccagttcacttcggatgggaggaccctt
atttcaagctcagatgattctacagttcaggtgtggaactggcattcagaggaatttgta
tttcttaaagctcaccaagaacccgtgaaggactttaggctcctgcagaattctcagctc
ctgacctggtcatttgatggtacagtgaaggtttggaatatccttactggcaaagtagag
aaggactttgtttgccaccaaggtactgttttgtcttgtgatatttctcccgacgccacc
aaattttcatctgcctctgctgacaagactgcaaagatttggagctttgagagccattcc
cctctccacgagctgaggggtcatgaaggctgtgtgcggtgctctgtcttctctggggat
agtgccctcctggccacgggagatgacaatggagaaatccggatatggaatgtgtccact
ggccagcggcttcattcctgtgtccctgtgactgtggagaaaggagagacagccttcgtg
ggctgggtgaccgacctccgcttctctcctgatagcagaacgctggtgtctgcgggggcc
tatctgaagtggtggaacgtggacaccggtgaatcgttacagaccttctacacaaatgga
accaacctcaagaccatacacgtgtctcctagtttcaaaacatatgtgactgttgataat
cttggaattttatatgtactccaagctttagaatga

DBGET integrated database retrieval system