KEGG   Sarcophilus harrisii (Tasmanian devil): 100932655
Entry
100932655         CDS       T02286                                 

Gene name
DDB1
Definition
(RefSeq) DNA damage-binding protein 1
  KO
K10610  DNA damage-binding protein 1
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03420  Nucleotide excision repair
shr04120  Ubiquitin mediated proteolysis
shr05161  Hepatitis B
shr05170  Human immunodeficiency virus 1 infection
shr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100932655 (DDB1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100932655 (DDB1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100932655 (DDB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100932655 (DDB1)
   05161 Hepatitis B
    100932655 (DDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:shr04121]
    100932655 (DDB1)
   03400 DNA repair and recombination proteins [BR:shr03400]
    100932655 (DDB1)
Ubiquitin system [BR:shr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Adoptor protein
     100932655 (DDB1)
DNA repair and recombination proteins [BR:shr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100932655 (DDB1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      100932655 (DDB1)
SSDB
Motif
Pfam: MMS1_N CPSF_A Beta_propel IQCJ-SCHIP1
Other DBs
NCBI-GeneID: 100932655
NCBI-ProteinID: XP_031797578
Ensembl: ENSSHAG00000011600
LinkDB
Position
6
AA seq 1140 aa
MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGK
IAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGI
IGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELQVIDVKFLYGCQAPTICF
VYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYH
NGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDL
RVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIV
DMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDSGRE
TDDTLVLSFVGQTRVLMLNGEEVEETELTGFVDDQQTFFCGNVAHQQLIQITSASVRLVS
QEPKALVSEWKEPQGKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVAC
LDITPLGDSNGMSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSH
YLLCALGDGALFYFGLSIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIY
SSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYES
PRKICYQEVSQCFGVLSSRIEVQDASGGTTALRPSASTQALSSSVSSSKLFSSSTAPHET
SFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEE
AEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTAEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEIL
DDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGET
STPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTER
KTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
NT seq 3423 nt   +upstreamnt  +downstreamnt
atgtcgtacaactacgtggtgacggcgcagaagcccacggccgtcaacggctgcgtgacg
ggtcacttcacttctgccgaagacttgaatctgctgattgccaaaaacacccgcctggag
atctatgtggtcaccgcagaggggctgcggcccgtcaaagaagtgggcatgtatggcaag
attgctgttatggagcttttccgtcccaagggagaaagtaaggacctgctctttatcttg
acggccaaatacaatgcctgcatcttggagtataagcagagtggggagagcatcgacatc
atcacccgagctcatggcaacgtccaggatcgcatcggtcgtccttccgagactggaatc
atcggcatcattgaccccgagtgccggatgatcggcctgcgcctgtacgatggcctcttt
aaggttatccccctggaccgggacaacaaagaattaaaagccttcaacattcgtctggag
gagctccaggtcatcgatgtcaagttcctctatggttgccaggcccccaccatctgcttt
gtctaccaggacccccagggacggcatgtcaagacctatgaagtatctcttcgagagaag
gaattcaataaaggcccttggaagcaggaaaatgtggaggcggaagcttcaatggtgatt
gcagtcccagagccttttggaggtgcaatcattattggccaagaatccatcacctatcac
aatggcgataagtacctagccattgcccctcccatcattaagcaaagcacaattgtgtgc
cacaatcgagtagatccgaatggttcccgttacctgctcggagacatggaaggtcggctc
ttcatgctgctgctggagaaagaggagcagatggacggcacggtgacccttaaggatctt
cgtgtggagcttctcggagagacctccattgccgaatgcttgacgtacctggacaacggg
gtcgtgtttgttggctcccgccttggcgactcccagcttgtaaagctcaatgtagacagc
aacgagcaaggctcttacgttgtggccatggaaacctttaccaatttgggtcccattgtg
gacatgtgtgtggtggatctggagagacagggccagggccagctggtcacgtgttctggg
gcttttaaggaaggctccttgcgtatcatccggaacgggatcggaatccatgagcacgcc
agcatcgacctacctggtatcaaaggcttatggcctctcaggtctgactctggccgagaa
accgatgacaccttggtgctgtcctttgtgggccagacgagagttctgatgttgaatgga
gaggaggtggaggaaacggagctgaccggatttgtggatgaccagcagactttcttctgt
gggaatgtggcccatcagcagctgatccagatcacctctgcctctgtgcggctcgtgagc
caggagcccaaggccttagtgagtgagtggaaggagccgcagggcaaaaacatcagcgtg
gcctcgtgcaacagcagccaggtggtggtggccgtgggcagggccctctactaccttcag
attcatcctcaggagctccggcagataagccacacagagatggagcacgaggtggcctgc
ttggacatcaccccgttgggggacagcaacggcatgtccccgctctgtgccatcggcctc
tggaccgacatctcggcccgcatcctgaagcttccctcgttcgagctgctgcacaaggag
atgctcgggggagagatcatccctcggtctatcctgatgaccacctttgagagcagccac
tacctcctctgtgccctgggagacggtgccctcttctacttcgggctcagcatcgagaca
ggcttgttgagcgaccggaagaaggtgactcttgggacacagcccacggtcctgaggaca
tttcgctcactctccaccaccaatgtcttcgcgtgctccgaccgccccaccgtcatctac
agcagcaaccacaagttagtcttctccaatgtcaacctcaaggaggtcaactacatgtgt
cccctcaactcggatggctaccccgacagcctggccttggccaacaacagcaccctcacc
atcggtaccattgacgaaattcagaagctgcacatccgcacagtgcccttgtacgagtct
ccaagaaagatttgctaccaggaagtgtcccagtgctttggggtcctctccagtcggatc
gaggtgcaggacgccagcggagggacgacggccctgcggcccagcgccagcacgcaggcc
ttgtccagcagcgtcagctccagcaagctgttctccagcagcacggcccctcacgagacg
tcttttggagaagaggttgaggtgcacaacctgctcatcattgatcagcacacctttgaa
gtgctccatgctcaccagttcctccagaacgagtatgctctcagcctggtctcctgcaag
cttggcaaagatcccaacacctacttcatcgtgggcactgccatggtataccccgaagag
gctgagcccaagcagggtcgcattgttgtgttccagtactcggacggcaaacttcagact
gtagctgagaaggaagtcaaaggtgctgtgtactccatggtggagttcaatgggaagctc
ttagccagcatcaacagcacggtgcgactttacgagtggaccgcagagaaagagctcagg
accgagtgcaatcattacaacaacatcatggccttgtatctgaagaccaagggcgatttc
attctggtcggtgacttgatgcgctctgtgctgcttctggcctacaagcccatggagggc
aactttgaagagattgcccgggactttaaccccaactggatgagtgccgtcgaaatctta
gatgacgacaacttcctgggggccgagaatgcttttaacttgtttgtgtgtcagaaggac
agcgctgccaccactgatgaggagcggcagcatctgcaggaggtggggctcttccacctg
ggcgagtttgtcaacgtcttctgccacggctccctggtgatgcagaacctcggggagacc
tccacccccacgcagggctccgtgctcttcggcacggtcaacggcatgatcggtctggtg
acctccctgtcagaaagctggtacaacctccttctggacatgcagaaccgactcaacaaa
gtcatcaaaagcgttggcaagatcgagcattccttctggagatcgtttcataccgaacgc
aagacagagccggctacaggtttcattgatggagatctgattgaaagtttcctggatatc
agccggcccaagatgcaggaagtcgtggctaacttacagtatgatgatggcagtgggatg
aagcgagaagccaccgcagatgacctgatcaaggttgtggaggagctgactcggatccat
tag

DBGET integrated database retrieval system