KEGG   Sarcophilus harrisii (Tasmanian devil): 100932966
Entry
100932966         CDS       T02286                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04022  cGMP-PKG signaling pathway
shr04141  Protein processing in endoplasmic reticulum
shr04151  PI3K-Akt signaling pathway
shr04211  Longevity regulating pathway
shr04261  Adrenergic signaling in cardiomyocytes
shr04668  TNF signaling pathway
shr04728  Dopaminergic synapse
shr04911  Insulin secretion
shr04915  Estrogen signaling pathway
shr04918  Thyroid hormone synthesis
shr04925  Aldosterone synthesis and secretion
shr04926  Relaxin signaling pathway
shr04927  Cortisol synthesis and secretion
shr04928  Parathyroid hormone synthesis, secretion and action
shr04934  Cushing syndrome
shr04935  Growth hormone synthesis, secretion and action
shr05020  Prion disease
shr05030  Cocaine addiction
shr05031  Amphetamine addiction
shr05034  Alcoholism
shr05161  Hepatitis B
shr05163  Human cytomegalovirus infection
shr05166  Human T-cell leukemia virus 1 infection
shr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100932966 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100932966 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100932966 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100932966 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100932966 (ATF6B)
   04915 Estrogen signaling pathway
    100932966 (ATF6B)
   04926 Relaxin signaling pathway
    100932966 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100932966 (ATF6B)
   04918 Thyroid hormone synthesis
    100932966 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100932966 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100932966 (ATF6B)
   04927 Cortisol synthesis and secretion
    100932966 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100932966 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100932966 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100932966 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100932966 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100932966 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100932966 (ATF6B)
   05031 Amphetamine addiction
    100932966 (ATF6B)
   05034 Alcoholism
    100932966 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100932966 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100932966 (ATF6B)
   05161 Hepatitis B
    100932966 (ATF6B)
   05163 Human cytomegalovirus infection
    100932966 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100932966 (ATF6B)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100932966 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GIT_CC DUF4407 YabA ZapB
Other DBs
NCBI-GeneID: 100932966
NCBI-ProteinID: XP_031820980
Ensembl: ENSSHAG00000010010
LinkDB
Position
4
AA seq 704 aa
MAAELLLLSEIADPTRFFADNLLSAEDWDRTLYNCLDEVTEDQVQLFRCLEQDVPFDSGS
VDMNVNITSPEPPWDPLPIFPDLQVKSEPSSPSLSFESSLLFKEPLSQVSVGEEVLGVKI
ESPSSPHCLLGKVLKPSFGAVQISVGFTPDDPSDIQTKTESISSSSSPSSEASLLSEEFP
SKPFVEEEALGLKKESPAPQLCLLGDVLTSPFGSVQINVGPNPDGPSGKALPHHKPPLPP
KPVMVTNVPLCLRNSPPNTTVLLQPLGQPPPVSSGSSVVLFQGPVQVQPPVGEGSASSTP
RLERKSIVPAPVLGTPCLPEVDAKVLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQVV
LSDNQQLRRENAALRRRLEGLLAENSELKFGSGNRKVICVMVFLLFIAFNFGPVSINEVP
PAPASPQMGREESWPQRHLLEFSEQGVVTGQDTQGIPLGHKESQPRPAAGQPYFKNLTTF
SKGAKELFLRDLDQFFLSSDCRHFNRTESLRLADELSGWVQRHQSGRKRSSQLRKIREKQ
KFHQWKKPPPAWSVPPRPSGPPERDSVSQLQLYHHPRHPQPEFLDAIDRREDTFYVVSFR
RDHLLLPAISHNKTSRPKMSLVMPAMTPNETLSGRGNTGDYEVMMQIECEVMDTRVIHIK
SSTVPPSLRKQPPPPSGNASGNPLPSTPSSSRQTPHQPFYLGHP
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggcggcagaactgctgctgctcagcgaaatcgccgatccgacgcgtttcttcgccgac
aacctgctcagcgccgaggactgggaccgcactctctataactgccttgatgaagtgacc
gaggatcaagtccagctcttcagatgtctggagcaggatgtcccgttcgatagcggctcc
gtggacatgaatgtgaacatcacctcccctgaacccccatgggacccactgcccatcttc
ccagacctacaggtgaagtcagaaccttcttccccttctctcagctttgagtcatcactt
ctcttcaaggagccccttagccaggtttctgtgggggaagaggtacttggtgtgaagata
gaatctcctagctctccacactgccttttggggaaagttctgaaaccttcatttggagct
gtccagattagtgtgggcttcaccccagatgacccctcagatatacagaccaagacagag
tccatctcatcttcttcctctcctagctcagaggcctcattgctctctgaagaattcccc
agtaagccctttgtagaagaggaggcactaggattaaaaaaagaatcaccagcccctcaa
ctctgccttctaggggatgtcctaacttccccatttggatcagtccagattaatgtgggt
cctaaccctgatggtccctcaggaaaggccctaccccaccataagccaccattgccacca
aagcctgttatggtgacaaatgtcccattgtgcctccgaaattcacctcccaatactaca
gttctattgcagccactaggccaacctccaccagtctcatctggatcttctgtagtcctt
ttccagggacctgttcaagtacaaccacctgtgggggaggggtcagcctcctccactccc
agattggagaggaagagcattgttccagctcctgtgcttgggactccatgtcttccagaa
gtggatgcaaaggtgctgaagcgtcagcagcggatgatcaagaaccgtgagtcagcctgt
cagtcccggcggaagaagaaggaatacctgcaggggctggaggcccgacttcaggtggtc
ctttcagacaaccaacagctccgccgtgagaatgcagctctccgacgacggcttgagggg
ctgctggcagagaacagtgaacttaagtttgggtctgggaacaggaaggtcatctgtgtc
atggtcttcctcctcttcattgccttcaactttgggcctgtcagcatcaatgaagtacct
ccagctccagcctcacctcagatgggaagggaagaatcttggccccagaggcacctccta
gagttctcagagcaaggggtagttactgggcaggacacccaaggcataccactaggccac
aaagaatcacagcctagacctgctgcaggccagccatatttcaagaatctaacaaccttt
tccaagggagccaaggagctatttctgagagacttagaccagtttttcctctcttctgac
tgtcgccacttcaaccggactgagtctctccggcttgcagatgaacttagtggctgggtc
cagcgacaccaaagtggaagaaagaggagttctcagctccgtaaaattagagaaaaacag
aaatttcaccaatggaagaaaccacctccagcctggtcagtccctcctcgaccctctggt
ccccctgaaagggactccgttagccagctgcagctgtatcatcaccccaggcatccacag
ccagaattcctagatgccattgaccgtcgggaagacacattttatgttgtctccttccga
agggatcacctattgctcccagcaatcagccacaacaaaacttctcgtccaaagatgtct
ttggtgatgccagctatgacccccaatgagaccctgtcaggccggggaaatacaggggac
tatgaggtgatgatgcagatcgaatgtgaggtcatggacaccagggtcatccacatcaag
agttccacagtgcccccctcccttcgaaagcagccccctcctccttcaggcaatgcttca
ggcaatcctttgccttctacacccagctcttctaggcaaactcctcatcagcccttctat
cttggtcatccctaa

DBGET integrated database retrieval system