KEGG   Sarcophilus harrisii (Tasmanian devil): 100933019
Entry
100933019         CDS       T02286                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1 isoform X6
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01522  Endocrine resistance
shr04012  ErbB signaling pathway
shr04062  Chemokine signaling pathway
shr04151  PI3K-Akt signaling pathway
shr04360  Axon guidance
shr04370  VEGF signaling pathway
shr04510  Focal adhesion
shr04670  Leukocyte transendothelial migration
shr04810  Regulation of actin cytoskeleton
shr04935  Growth hormone synthesis, secretion and action
shr05100  Bacterial invasion of epithelial cells
shr05135  Yersinia infection
shr05146  Amoebiasis
shr05163  Human cytomegalovirus infection
shr05165  Human papillomavirus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05205  Proteoglycans in cancer
shr05222  Small cell lung cancer
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100933019 (PTK2)
   04370 VEGF signaling pathway
    100933019 (PTK2)
   04151 PI3K-Akt signaling pathway
    100933019 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100933019 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100933019 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100933019 (PTK2)
   04062 Chemokine signaling pathway
    100933019 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100933019 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    100933019 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100933019 (PTK2)
   05202 Transcriptional misregulation in cancer
    100933019 (PTK2)
   05205 Proteoglycans in cancer
    100933019 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100933019 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100933019 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100933019 (PTK2)
   05100 Bacterial invasion of epithelial cells
    100933019 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100933019 (PTK2)
   05163 Human cytomegalovirus infection
    100933019 (PTK2)
   05165 Human papillomavirus infection
    100933019 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100933019 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100933019 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:shr01001]
    100933019 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:shr01009]
    100933019 (PTK2)
Enzymes [BR:shr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100933019 (PTK2)
Protein kinases [BR:shr01001]
 Non-receptor tyrosine kinases
  FAK family
   100933019 (PTK2)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100933019 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 100933019
NCBI-ProteinID: XP_012397302
Ensembl: ENSSHAG00000011092
LinkDB
Position
1
AA seq 1134 aa
MPREPPAGSGLESEAWEPLTRASGREGFDELLWNRIKETRRFFNISFLFDHSDPVVTCFY
ISRLYFLKEYDRYLASSKTMAAAYLDPNLNHTPSSSTKTHLSTGMERSPGAMERVLKVFH
YFENSSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHLD
MGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKNDYMLEIAD
QVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLESVKAKTLR
KLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGIS
YLTDKGSNPTHLADFNQVQTIQYSNSDDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMA
DLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKLANNEKQGVRTHTVSVSETDDYAEII
DEEDTYTMPSTRDYEIQRERIELGRCIGEGQFGDVHQGVYMSPENPAMAVAIKTCKNCTS
DSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLA
SLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSTDCVKLGDFGLSRYMEDSTYYKASK
GKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERL
PMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQQEERMRMESRRQVTV
SWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQANHYQVSGYTGSHGITAMAGSIY
PGQASLLDQTESWNHRPQEVSMWQPNMEDSASLDMRGLGQVLPAHLMEERLIRQQQEMEE
DQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPTGNQHIYQPVGKPDPAAPPKKPPRPGA
PSHLGSLASLNSPVDSYNEGVKPWRLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEM
SSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELI
NKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKMLGQARPH
NT seq 3405 nt   +upstreamnt  +downstreamnt
atgccccgtgagcccccggctggctctggtctggagtcggaagcctgggagcccctgacc
cgggcgagcggccgcgagggttttgacgagctactatggaacaggataaaagaaactagg
agattttttaatatcagttttctctttgaccacagtgatcctgttgtaacttgtttctat
atttcaagactttactttctaaaagaatatgacagatacctagcatctagcaaaaccatg
gcagctgcttatcttgacccaaacttgaatcacaccccaagttcgagtaccaagacacac
ctcagtactgggatggagcgttctcctggggccatggagcgagtattaaaagtctttcat
tattttgaaaatagtagtgagccaaccacatgggccagtattatcaggcatggagatgcc
actgatgtcagaggcatcattcagaagattgtggacagtcacaaagtaaagcatgtggcc
tgttatggatttcgactcagtcatcttcgttcagaggaagttcactggctacatctggat
atgggtgtttccaatgtgagagaaaaatatgaactagctcacccaccagaggagtggaag
tatgaattgagaattcgttacttgccaaaaggatttttgaaccagtttacagaagacaag
ccaactttgaatttcttttatcagcaggtgaaaaacgactatatgttagaaatagctgat
caagtggaccaggaaattgctttgaagttgggttgccttgaaatacggagatcgtactgg
gaaatgaggggcaatgccctggagaagaaatctaactatgaagtattagaaaaggatgtt
ggtttaaagagattttttcctaagagtttgctggaatctgtcaaggccaaaaccctcaga
aaattgatacaacaaacatttcgtcagtttgccaatcttaatagagaagaaagtattctg
aaattctttgaaattctctctccggtgtacagatttgataaagaatgcttcaaatgtgct
cttgggtcaagttggatcatttctgtggagctggcaattggcccagaagaaggcatcagt
taccttacagacaagggctccaatcctacacatcttgcagacttcaatcaagttcagacc
attcagtattcaaacagtgatgacaaagacagaaaaggaatgctgcaactgaaaatagca
ggagcacctgagcctctcacagtgacagccccatctttaaccattgcagagaatatggct
gacttaatagatggatattgccgactagttaatggagctacacaatcttttatcattaga
cctcagaaagaaggtgaacgagccttaccatcaataccaaagctagccaacaatgagaag
caaggagtaaggacacatacagtctctgtatcagaaacagatgactatgctgaaattata
gatgaagaagatacttatacaatgccctcaaccagggattatgagatacaaagagaaagg
atagaacttggacgctgtattggagaaggccagtttggagacgtacatcaaggagtttac
atgagtccagagaatccagcaatggcagttgcaattaaaacatgtaaaaactgtacctct
gacagtgtgagagaaaaattccttcaagaagccttaacaatgcgtcaatttgatcaccca
catattgtgaagttgattggagttataacagaaaaccctgtctggataatcatggaactc
tgcacactaggagagctgcggtcatttttgcaagtgagaaaatacagcttggatttggca
tctttgattctatatgcttaccagcttagtacagcccttgcctacctagaaagtaaaaga
tttgtgcatagggacattgctgctagaaatgtgctggtatcttcaactgactgtgtaaaa
ttaggagactttggtttgtctcgatatatggaagatagtacttactacaaagcttctaag
ggaaaattacctattaaatggatggctccagagtcaatcaattttagacgttttacctca
gctagtgatgtgtggatgtttggtgtgtgcatgtgggaaattttgatgcatggtgtaaag
ccttttcaaggagtgaagaacaatgatgtaattggtcgaattgaaaatggtgaacgattg
ccaatgcctccaaattgtcctcctaccctctacagccttatgacaaagtgctgggcatat
gatcccagtagaagacccaggtttactgaactcaaagcacagctcagtacaatactggag
gaagagaagctccagcaagaagaacgaatgagaatggaatcaagaaggcaagtcacagtg
tcctgggattcaggaggctcagatgaagctcctcccaagcccagccgacctggttaccct
agcccaagatccagtgaaggtttttatcctagtccacaacatatggtacaagccaatcat
tatcaggtctctggttatactggttctcatggaataacagctatggctggcagcatttat
cctggtcaggcatctctgttggatcaaacagagtcttggaaccaccgacctcaagaagta
tcaatgtggcagcccaacatggaggactctgcctcgttggacatgaggggattaggccaa
gttcttccagcgcatcttatggaagagaggttgatacgacagcagcaggaaatggaagaa
gatcaacgttggcttgagaaggaagagagatttttgaaacctgatgtgaggctttctcga
ggcagtattgaccgagaggatggaagtcttcagggtccgactggtaaccagcacatatat
caaccggtgggtaagccagatcctgcagctccaccaaagaaaccacctcgaccaggagca
cccagccatctaggaagcctggccagcctcaacagccctgtggatagttataatgaggga
gtgaagccatggaggctgcagccccaggaaatcagcccccctcctactgccaatctggac
cgctccaatgacaaggtctatgagaatgtaactggcctggtgaaagctgtcatagaaatg
tccagcaagatccagcctgcaccgccagaggaatatgtccctatggtaaaggaagttggc
ttggccctaagaacattgctagcaacagtggacgagaccattcccctgcttccagcaagc
actcacagagagattgagatggcccaaaagctattgaattcggacttgggtgagctgatc
aacaagatgaaactggcacaacaatacgtcatgaccagcctccagcaggaatacaaaaag
caaatgctaactgctgctcatgcactggctgtagatgccaaaaacttactagatgtcatt
gatcaagcaagactgaaaatgctagggcaggccaggccacactga

DBGET integrated database retrieval system