KEGG   Sarcophilus harrisii (Tasmanian devil): 100933581
Entry
100933581         CDS       T02286                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr04062  Chemokine signaling pathway
shr04066  HIF-1 signaling pathway
shr04068  FoxO signaling pathway
shr04217  Necroptosis
shr04550  Signaling pathways regulating pluripotency of stem cells
shr04630  JAK-STAT signaling pathway
shr04659  Th17 cell differentiation
shr04917  Prolactin signaling pathway
shr04920  Adipocytokine signaling pathway
shr04931  Insulin resistance
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr04935  Growth hormone synthesis, secretion and action
shr05145  Toxoplasmosis
shr05160  Hepatitis C
shr05161  Hepatitis B
shr05162  Measles
shr05163  Human cytomegalovirus infection
shr05167  Kaposi sarcoma-associated herpesvirus infection
shr05169  Epstein-Barr virus infection
shr05200  Pathways in cancer
shr05203  Viral carcinogenesis
shr05205  Proteoglycans in cancer
shr05206  MicroRNAs in cancer
shr05212  Pancreatic cancer
shr05221  Acute myeloid leukemia
shr05223  Non-small cell lung cancer
shr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
shr05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100933581 (STAT3)
   04066 HIF-1 signaling pathway
    100933581 (STAT3)
   04068 FoxO signaling pathway
    100933581 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100933581 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100933581 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100933581 (STAT3)
   04062 Chemokine signaling pathway
    100933581 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100933581 (STAT3)
   04917 Prolactin signaling pathway
    100933581 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    100933581 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100933581 (STAT3)
   05206 MicroRNAs in cancer
    100933581 (STAT3)
   05205 Proteoglycans in cancer
    100933581 (STAT3)
   05203 Viral carcinogenesis
    100933581 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100933581 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100933581 (STAT3)
   05221 Acute myeloid leukemia
    100933581 (STAT3)
   05223 Non-small cell lung cancer
    100933581 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100933581 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100933581 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100933581 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    100933581 (STAT3)
   05161 Hepatitis B
    100933581 (STAT3)
   05160 Hepatitis C
    100933581 (STAT3)
   05163 Human cytomegalovirus infection
    100933581 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100933581 (STAT3)
   05169 Epstein-Barr virus infection
    100933581 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100933581 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100933581 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100933581 (STAT3)
Transcription factors [BR:shr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    100933581 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 DUF4795 AP1AR Baculo_PEP_C Syntaxin-6_N Fib_alpha
Other DBs
NCBI-GeneID: 100933581
NCBI-ProteinID: XP_023358082
Ensembl: ENSSHAG00000014833
LinkDB
Position
4
AA seq 771 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NLLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSTGGGQFETLTFDMELTSECASSPM
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcacaatggaatcagctgcagcagcttgacacacggtatttggagcagcttcaccag
ttgtacagtgacagctttcccatggagcttcggcaattcctggctccctggatagagagc
caggactgggcatatgctgccagtaaagaatcacacgccaccttggtcttccacaacctc
ttgggtgagattgatcagcagtacagtcgcttccttcaggaatcaaatgtgctttatcaa
cacaacctgcgaagaatcaagcaattcctacagagcagatatcttgaaaagccaatggag
attgccaggattgtggctcggtgcctgtgggaggagtctcgactccttcagacagcagcc
acagctgcccagcaaggagggcaagccaaccaccccacagctgctgtggtgacagaaaaa
caacagatgctagaacaacacttgcaggatgtgcggaaacgagtacaggatctggaacag
aagatgaaagtggtggagaatctccaggatgactttgatttcaactacaagaccctgaaa
agtcaaggagacatgcaagatctaaatggaaacaaccaatcagtgactaggcaaaagatg
cagcagctggaacagatgctgactgcccttgaccagatgcgaaggggaattgtgagtgaa
ttagcaggccttctttcagccatggagtatgtgcagaagactcttacagatgaagaactg
gctgactggaagaggagacaacaaattgcttgtattggaggccctcccaacatctgcctg
gatcgcctagaaaactggataacttccttagctgaatctcagctccagacccgtcagcag
ataaagaaactggaagaattacagcagaaagtctcctacaaaggtgaccctatcgtccaa
caccgacctatgctggaagagagaattgtggagctttttagaaatttaatgaaaagtgcc
tttgttgtagagcggcagccctgcatgcctatgcaccctgatcggcccttggtcatcaag
acaggtgttcaattcactaccaaagtcaggttattggtcaaatttcctgaattaaactat
caacttaaaattaaagtgtgcattgacaaagactctggtgatgttgcggcattaagaggg
tcccgaaaattcaacattctgggaacaaatacgaaagttatgaacatggaggagtccaac
aacggaagtctctctgcagagttcaaacacttgaccctgagggagcagagatgcggcaat
ggtggtcgggccaactgtgatgcctctctgatagtgactgaagaacttcatctcatcacc
tttgagacagaagtttaccatcaaggcctaaagattgacttggagacacactctttacca
gtggtggtgatctctaatatttgtcagatgccaaatgcttgggcttcaatcctttggtat
aatctgttgaccaataaccccaagaatgttaacttcttcaccaagcctcctattgggaca
tgggatcaagttgctgaggtgctaagctggcagttttcctccaccacgaagaggggcttg
agcattgagcagttgaccacactagcagagaagcttttaggacctggtgtgaattattca
ggatgccagatcacatgggccaaattttgcaaagaaaacatggctggcaaaggtttctcc
ttctgggtttggttggacaacattattgaccttgtgaagaagtacattttggcactgtgg
aatgaagggtacataatgggattcattagcaaggaacgagaacgagccatcctgagcacg
aaacctcctgggacctttctgctgaggttcagcgagagcagcaaagagggagggatcacc
ttcacctgggtggagaaggatatcagtggcaagacgcagatccagtccgtggaaccatat
acaaagcagcagctaaacaatatgtcctttgctgaaatcatcatgggctataaaatcatg
gatgccaccaacatcctggtgtctcctctggtctatctctaccctgacattcctaaggag
gaggcatttggaaagtattgccggccagagagtcaggagcatccggaagctgacccaggt
agtgctgctccatacctgaagaccaagtttatctgtgtgaccccaacgacctgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggagctgagccctcaacaggagggggacagtttgagaccctcacgtttgacatg
gaattgacttctgaatgtgcttcatctcccatgtga

DBGET integrated database retrieval system