KEGG   Sarcophilus harrisii (Tasmanian devil): 100933904Help
Entry
100933904         CDS       T02286                                 

Gene name
LCT
Definition
(RefSeq) lactase-phlorizin hydrolase
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00052  Galactose metabolism
shr01100  Metabolic pathways
shr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:shr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100933904 (LCT)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100933904 (LCT)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     100933904 (LCT)
    3.2.1.108  lactase
     100933904 (LCT)
Chaperones and folding catalysts [BR:shr03110]
 Intramolecular chaperones
  Others
   100933904 (LCT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Peptidase_M19
Motif
Other DBs
NCBI-GeneID: 100933904
NCBI-ProteinID: XP_012400139
Ensembl: ENSSHAG00000017319
LinkDB All DBs
Position
3
AA seq 1356 aa AA seqDB search
PKVAHSILKAHAKAWHYYDRHQRAQQRGQVGIVLNSDWAEPYSAEGEDVAAAERYLHAML
GWFAHPLFVDGDYPASLRTQIQLKNRQCGRAVAQMPAFTEEEKLLLKGSSDFLGLSHYTS
RLVKDAQNGSCGPDYDSLRGFSQHVDPRWPQTACPWLRVVPWGLRRLLQFASLEYTKGKV
PIYLAANGLPTEGRDLDDSARRDYFKLYVNEVLKAIKLDLVDVRSYIVRSLIDGFEGPSG
YNQRFGLHYVDFKDGSRPRTPRKSAYFFSSLIKKNSLEIKKIDRTSQPFIHSLPDTTPLV
LGPSEVPSKAKVVWEKFSNQSKFERDLFHHGTFPDDFVWGVSSSAYQIEGGWNADGKGPS
IWDNFTHTPGNNVINNDNGDVACDSYNKLEEDLNMLRALRVTAYRFSLSWSRIFPTGTND
SVNKYGVDYYNRLIDGLAASNITPMVTLYHWDLPQALQDIGGWDNSSLIELFDSYADFCF
RTFGDRVRFWMTFNEPMYQAWLGYGEGVFPPNVKDPGYGPYRIAHTLIKAHARVYHTYDQ
KYRPSQKGVISLSLSTHWMEPKSPHLPRDVEAADRALQFNLGWFAHPIFKNGDYPDAMKW
KVGNRSELQNLPASRLPSFTEQEKRYIRNTADVFCLNTYSTKVVSHRTPPLQPPSYDSDQ
ERTEEEELSGPPSALHRAVPWGLRRVLNWIKEEYGNKQIYITENGVGLKKSQIEDIDRKF
FYKTYINEALKAYSLDGVNLRGYVAWSLMDNFEWLNGYSVKFGLYQVDFNDPNRPRTART
SARYYTEVISNNGMPSSKEDEFLYGEFPKGFIWSAASAAYQIEGAWRADGKGLSIWDTYS
HTPLRIANDDTGDVACDSYHKIQEDLVALQNLGVSHYRFSISWPRVLPDGTTRQINEEGL
KYYERLIDALMAANITPQVTIYHWDLPQALQNVGGWENDTIIQRFKEYADVLFSRLGTKV
KFWITLNEPYVIANLGHGYGTAAPGISFRPGTAPYIVGHNLIKAHAEAWHLYNDVYRPTQ
GGLISITISSDWAEPRDPSKQEDVEAARRYVQFMGGWFAHPIFKNGDYSEVMKTRIRDRS
LAAGLSKSRLPEFTEDEKKRINGTFDFFGFNHYTTILASNLNYANIISSYDADRGVASIT
DRTWPDSGSFWLKITPFGFRRILNWLKEEYNNPPIYITENGVSERGTSDLNDTVRIYYLR
SYINEVLKAIIQDKVDIRGYTVWSLMDNFEWATGFSERFGLHFTNYTDPSIPRIPKESVK
LYASVVRCNGFPDPASGPHLCLQAQDIPTTESVTDKQVQFLGLTLDATNAETALYILFSF
LIFFLIIGICGLAFTFYKYKVSKKSPSTSQQELSKM
NT seq 4071 nt NT seq  +upstreamnt  +downstreamnt
cccaaggtggctcactccatcctcaaggcccacgccaaggcctggcactattacgaccgc
caccagcgcgcccagcagcgcggccaggtcgggatcgtgctgaactcggactgggccgag
ccctactctgccgagggggaggatgtggcggcggccgagcgctacctgcacgccatgctg
ggctggttcgcccacccgctctttgtggacggcgactaccccgcctcgctgaggacccag
atccagctgaaaaaccggcagtgtggccgcgccgtggcccagatgcccgccttcaccgag
gaagagaagctgctcttgaagggctcctcggactttctgggcctgtcccattacacctcc
cgcctggttaaggatgcgcagaacggctcctgcggcccggactacgacagtctccgcggt
ttctcgcagcacgtggacccccgttggccccagactgcatgtccttggcttcgggtggtc
ccctggggtctcaggaggcttttacagtttgcctccctggaatacaccaaagggaaggtt
cccatctacctggctgccaatggcctgcccacggaaggcagagaccttgatgactctgca
agacgagactatttcaagctctatgtcaatgaggtgctcaaagctatcaagttggacttg
gtggatgttcggtcctacattgttcgttccctcattgatggctttgaaggcccctccggt
tacaaccaaagatttgggctacactatgtggatttcaaagatggtagcagacccagaacc
cccaggaagtctgcctattttttctccagccttatcaaaaagaatagcttggagattaaa
aagatagacagaacttctcagccattcattcatagccttcctgacacaactcctcttgtt
ttgggaccctcggaggttccttccaaggctaaggtagtttgggaaaaattctccaatcaa
tccaagtttgaaagagatctcttccaccacggaacattcccggatgactttgtctggggt
gtgtcctcctccgcctatcagatcgaaggaggctggaatgcagacgggaagggccccagc
atctgggataacttcacccacactcccgggaacaatgtgatcaacaatgataacggagat
gtggcttgtgatagttacaataagttggaggaggacctgaatatgctgagagctttgaga
gtcacggcctatcgcttctccctctcctggtcccgaatcttcccaacagggacaaatgat
tctgtcaacaaatacggagttgactactacaaccggctcatcgatgggttggcggccagc
aacatcacccccatggtgaccctgtaccactgggacctcccccaagccctgcaggatatt
ggggggtgggacaactcttccttgattgagctgtttgacagctacgcagacttttgcttc
cgcacttttggcgatcgggtccgattctggatgacgtttaatgagcccatgtatcaggcc
tggttaggctacggcgaaggtgtattccccccaaatgtgaaggatcccggctatgggcct
tacagaatcgcccacaccctcatcaaagctcatgcccgagtttaccacacgtacgatcaa
aagtacaggccgagtcagaaaggagtcatttccctgagcctcagcacgcattggatggag
cccaagtcgccgcatttgccgagagacgtcgaggcggctgatcgggccctgcagtttaac
ttgggctggtttgcccaccccatctttaaaaacggggattaccccgatgctatgaagtgg
aaagtgggcaaccggagcgagctgcagaatctgcccgcttctcgcctccccagcttcacg
gagcaggaaaagcgctacatcagaaacacggcggacgtcttctgtctcaacacctactcc
accaaagttgtgtcccacagaactcctccgctgcagcctccctcctacgatagcgaccag
gagaggaccgaggaggaggagctgtctgggcctcccagtgccctgcacagggcagtgccc
tggggtctcagaagggtcctgaactggatcaaggaagaatatggcaacaagcaaatttac
atcacagaaaatggagtgggactcaagaagtctcaaattgaagacatcgataggaagttt
ttttacaaaacgtacatcaatgaggctttgaaagcctacagtctggacggtgtcaacctc
cgcgggtatgtggcttggtccctgatggacaactttgaatggctgaatggctacagtgtc
aagtttggattatatcaagtagattttaatgaccccaaccgaccccggactgcaagaact
tccgccaggtactacacagaagttattagcaacaatggcatgccatcgagcaaagaggat
gagtttttgtatggagagtttccgaaaggctttatctggagtgcagcttccgcagcctat
cagattgagggtgcctggagagctgatggcaagggcctcagtatctgggatacctattcc
catactccgctaaggattgcaaatgatgacactggcgacgtggcctgtgacagctatcac
aaaatccaagaagatctggtggctcttcagaatctcggcgtgtcccactatcgcttctcc
atctcctggcctcgtgttctccctgatgggactacaaggcaaatcaatgaagaagggctc
aagtactatgaaagactcattgatgcactaatggcagccaatattacacctcaggtgact
atttaccactgggatctgccccaggcactccagaatgttggaggctgggagaatgatacc
ataatccagaggtttaaggaatatgcagatgtgctcttcagtaggctgggaaccaaagtg
aagttttggatcactctcaatgagccctatgtcattgccaacctgggccatggctatgga
acagctgctccaggcatttcctttagaccaggcactgctccctatattgttggccataac
ttaataaaagctcatgctgaagcctggcacctgtataatgatgtctaccgacccacgcaa
ggaggactgatttctatcaccatcagcagtgactgggcagaacccagggatccttccaaa
caagaagatgtggaagctgccagaagatatgttcagtttatgggaggctggtttgcacat
cctattttcaagaatggagactacagtgaagtcatgaagacccggattagggacaggagc
ctggcagcaggactcagcaaatccaggctcccagagtttactgaagatgaaaagaagaga
attaatggcacatttgatttttttggcttcaatcattataccactattctggcttctaac
ctgaattatgcaaatataatctcctcctatgatgcagacaggggagtggcttccataaca
gatcgcacttggccagattccggctctttttggctgaagattactccttttggctttaga
aggatcttgaactggttaaaggaagagtacaacaaccctccaatttatattacagagaat
ggggtttctgagagaggaacctcagacctcaatgacaccgtaagaatctactacctccgg
agttacatcaatgaagttctcaaagctattatacaggataaggtggacatccgtggctac
actgtttggagtttgatggacaattttgaatgggctactggcttttcagagagatttggt
ctacatttcaccaactacacagacccttccatcccaaggatccccaaggaatctgtcaag
ttgtatgcctctgtagtcaggtgcaatggcttcccagacccagccagcgggccgcacctc
tgcctccaggcccaagatattcccaccactgaatctgtgacagacaagcaagttcagttc
ttggggctaacactggatgccaccaatgcagaaacagctttatacatactcttttctttc
ttgattttctttctgattattggtatctgtggactagcatttacattctataaatacaag
gtgtctaagaaaagtccaagtaccagccaacaggaattgagtaaaatgtag

DBGET integrated database retrieval system