KEGG   Sarcophilus harrisii (Tasmanian devil): 100934154
Entry
100934154         CDS       T02286                                 

Gene name
PPARG
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma isoform X1
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr03320  PPAR signaling pathway
shr04152  AMPK signaling pathway
shr04211  Longevity regulating pathway
shr04380  Osteoclast differentiation
shr04714  Thermogenesis
shr05016  Huntington disease
shr05200  Pathways in cancer
shr05202  Transcriptional misregulation in cancer
shr05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100934154 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100934154 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100934154 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    100934154 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    100934154 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100934154 (PPARG)
   05202 Transcriptional misregulation in cancer
    100934154 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100934154 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100934154 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:shr03000]
    100934154 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:shr03310]
    100934154 (PPARG)
Transcription factors [BR:shr03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100934154 (PPARG)
Nuclear receptors [BR:shr03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   100934154 (PPARG)
SSDB
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Other DBs
NCBI-GeneID: 100934154
NCBI-ProteinID: XP_023353962
Ensembl: ENSSHAG00000008610
LinkDB
Position
1
AA seq 475 aa
MVDTEMPFWPTNFGISSVDLSVMDDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRADPMV
PDYKYDLKLQECPSAIKVEPPSPPYYSEKTQLYNKPHEESSNSLMAIECRVCGDKASGFH
YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF
GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTT
DKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKN
IPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGD
FMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK
LNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggttgacacagagatgccattttggcccaccaactttgggatcagctccgtggatctg
tctgtcatggatgaccactcccactcttttgacatcaaaccctttaccactgttgacttc
tccagcatttccaccccacattatgaagacattccattcacaagggctgaccccatggtt
cctgattacaagtatgacctgaaactccaagaatgcccaagtgctatcaaagtggaaccc
ccatcccctccttattattcagaaaaaacccagctctacaataagcctcatgaagagtcc
tcgaattcccttatggccatcgaatgccgagtctgtggggataaagcttctgggttccac
tatggtgtacatgcttgtgaaggctgcaagggtttcttccggaggacaatccgtttgaaa
cttatctatgaccggtgtgatctgaactgtcggatccacaaaaagagtagaaataaatgt
cagtactgcaggtttcagaagtgccttgctgtggggatgtcacataatgcgatcaggttt
gggcggatgccacaggccgagaaggagaagctgttggctgagatctccagtgatatcgac
cagctgaacccagagtctgctgatctccgagccctggcaaaacatctgtatgactcatac
ataaagtccttccctctgaccaaagccaaggcgagggcgatcttgacaggaaagacgaca
gacaaatcaccatttgttatttatgacatgaactccttaatgatgggagaagacaagatt
aagtttaagcacatcacacccctgcaggaacaaagcaaagaagtagccatccgcattttc
caggggtgtcagttccgttctgtggaagccgtccaggagatcaccgaatacgccaagaac
attccgggtttcgtcaaccttgacttgaatgaccaagtgaccctcttgaagtatggtgtc
catgagatcatctacaccatgctggcctccttgatgaataaagatggggttctcatatcc
gagggccaaggattcatgacgagggaatttctgaagagcctgagaaaaccctttggtgat
tttatggagcccaagtttgagtttgctgtaaagttcaatgcactggaattagatgatagc
gacctagcaatatttatagctgtcatcatcctcagtggagatcgccctggtttgctgaac
gtaaagcctattgaggacatccaggataacttgttgcaggccttggagctccagctcaag
ctgaaccaccctgaatcgtcccaactgtttgccaagttgcttcaaaaaatgacagacctc
agacagattgtaacagagcacgtgcagctgttgcaagttatcaagaaaacagagacggac
atgagccttcatccactcctacaagagatctacaaggacttgtattag

DBGET integrated database retrieval system