KEGG   Sarcophilus harrisii (Tasmanian devil): 100934666
Entry
100934666         CDS       T02286                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr01521  EGFR tyrosine kinase inhibitor resistance
shr01522  Endocrine resistance
shr01524  Platinum drug resistance
shr04064  NF-kappa B signaling pathway
shr04066  HIF-1 signaling pathway
shr04071  Sphingolipid signaling pathway
shr04115  p53 signaling pathway
shr04140  Autophagy - animal
shr04141  Protein processing in endoplasmic reticulum
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04215  Apoptosis - multiple species
shr04217  Necroptosis
shr04261  Adrenergic signaling in cardiomyocytes
shr04340  Hedgehog signaling pathway
shr04510  Focal adhesion
shr04621  NOD-like receptor signaling pathway
shr04630  JAK-STAT signaling pathway
shr04722  Neurotrophin signaling pathway
shr04725  Cholinergic synapse
shr04915  Estrogen signaling pathway
shr04928  Parathyroid hormone synthesis, secretion and action
shr04933  AGE-RAGE signaling pathway in diabetic complications
shr05014  Amyotrophic lateral sclerosis
shr05022  Pathways of neurodegeneration - multiple diseases
shr05132  Salmonella infection
shr05145  Toxoplasmosis
shr05152  Tuberculosis
shr05161  Hepatitis B
shr05162  Measles
shr05168  Herpes simplex virus 1 infection
shr05169  Epstein-Barr virus infection
shr05170  Human immunodeficiency virus 1 infection
shr05200  Pathways in cancer
shr05206  MicroRNAs in cancer
shr05210  Colorectal cancer
shr05215  Prostate cancer
shr05222  Small cell lung cancer
shr05226  Gastric cancer
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100934666 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100934666 (BCL2)
   04630 JAK-STAT signaling pathway
    100934666 (BCL2)
   04064 NF-kappa B signaling pathway
    100934666 (BCL2)
   04066 HIF-1 signaling pathway
    100934666 (BCL2)
   04071 Sphingolipid signaling pathway
    100934666 (BCL2)
   04151 PI3K-Akt signaling pathway
    100934666 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100934666 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    100934666 (BCL2)
   04215 Apoptosis - multiple species
    100934666 (BCL2)
   04217 Necroptosis
    100934666 (BCL2)
   04115 p53 signaling pathway
    100934666 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100934666 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100934666 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100934666 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    100934666 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100934666 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    100934666 (BCL2)
   04722 Neurotrophin signaling pathway
    100934666 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100934666 (BCL2)
   05206 MicroRNAs in cancer
    100934666 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100934666 (BCL2)
   05226 Gastric cancer
    100934666 (BCL2)
   05215 Prostate cancer
    100934666 (BCL2)
   05222 Small cell lung cancer
    100934666 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100934666 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100934666 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100934666 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100934666 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100934666 (BCL2)
   05152 Tuberculosis
    100934666 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100934666 (BCL2)
   05161 Hepatitis B
    100934666 (BCL2)
   05162 Measles
    100934666 (BCL2)
   05168 Herpes simplex virus 1 infection
    100934666 (BCL2)
   05169 Epstein-Barr virus infection
    100934666 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100934666 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100934666 (BCL2)
   01524 Platinum drug resistance
    100934666 (BCL2)
   01522 Endocrine resistance
    100934666 (BCL2)
Protein phosphatases and associated proteins [BR:shr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100934666 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 100934666
NCBI-ProteinID: XP_031802037
LinkDB
Position
1
AA seq 255 aa
MAHPGRRGYDNREIVMKYIHYKLSQRGYEWDAGNLRTPASPSLPPVVASAPAVGIFSNQP
RHTPLPAAPQDLATSTTAAARNSPLPPPPAVAAATVAAGPAVSPVPPVVHLTLRQAGDDF
SRRYRRDFDEMSGQLHLTPVTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNR
EMSPLVDSIALWMTEYLNRHLHNWIQDNGGWDAFVELYGNSMRPLFDFSWLSLKTLLSLA
LVGACITLGAYLGHK
NT seq 768 nt   +upstreamnt  +downstreamnt
atggctcaccctggaagaagaggatatgataaccgggaaatagtgatgaaatacattcat
tataagctatcacagagagggtacgagtgggatgctggaaatctgaggacaccagcctct
ccaagtcttcctcctgttgttgcttctgcccctgctgttggaatcttctctaaccagcca
agacatacacctctgcctgctgcaccccaggacttggccacttctactactgctgctgct
agaaactcacctttgcctcctcctcctgctgttgctgctgctactgttgctgctggacca
gctgtcagtccagtgccacctgtggtccacctgactcttcgtcaagctggagatgatttc
tctcgaagatatcgaagagatttcgatgaaatgtcaggtcagctgcacctgacccctgtt
actgctaggggacgctttgccacagtagtggaagagctgttcagggatggggtgaactgg
gggcggattgtggccttctttgaatttggtggtgttatgtgtgtggagagcgtcaaccgg
gagatgtcgcctctggtggacagcatagccctgtggatgactgagtacctgaaccggcac
ctgcacaactggatccaggataacggaggatgggatgcctttgtggaattatatggcaac
agcatgagacctttgttcgatttctcctggctgtctctgaagactctcctcagcctggct
ctggtgggagcttgcatcactcttggtgcctacctaggacacaagtga

DBGET integrated database retrieval system