KEGG   Sarcophilus harrisii (Tasmanian devil): 100935068
Entry
100935068         CDS       T02286                                 

Definition
(RefSeq) uncharacterized LOC100935068 precursor
  KO
K05429  interleukin 2
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04060  Cytokine-cytokine receptor interaction
shr04061  Viral protein interaction with cytokine and cytokine receptor
shr04151  PI3K-Akt signaling pathway
shr04625  C-type lectin receptor signaling pathway
shr04630  JAK-STAT signaling pathway
shr04658  Th1 and Th2 cell differentiation
shr04659  Th17 cell differentiation
shr04660  T cell receptor signaling pathway
shr04672  Intestinal immune network for IgA production
shr04940  Type I diabetes mellitus
shr05135  Yersinia infection
shr05142  Chagas disease
shr05162  Measles
shr05166  Human T-cell leukemia virus 1 infection
shr05200  Pathways in cancer
shr05320  Autoimmune thyroid disease
shr05321  Inflammatory bowel disease
shr05330  Allograft rejection
shr05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100935068
   04151 PI3K-Akt signaling pathway
    100935068
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100935068
   04061 Viral protein interaction with cytokine and cytokine receptor
    100935068
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100935068
   04660 T cell receptor signaling pathway
    100935068
   04658 Th1 and Th2 cell differentiation
    100935068
   04659 Th17 cell differentiation
    100935068
   04672 Intestinal immune network for IgA production
    100935068
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100935068
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100935068
   05321 Inflammatory bowel disease
    100935068
   05330 Allograft rejection
    100935068
   05332 Graft-versus-host disease
    100935068
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100935068
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100935068
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100935068
   05162 Measles
    100935068
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100935068
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:shr04052]
    100935068
   00536 Glycosaminoglycan binding proteins [BR:shr00536]
    100935068
Cytokines and growth factors [BR:shr04052]
 Cytokines
  Interleukins
   100935068
Glycosaminoglycan binding proteins [BR:shr00536]
 Heparan sulfate / Haparin
  Cytokines
   100935068
SSDB
Motif
Pfam: IL2 IL15
Other DBs
NCBI-GeneID: 100935068
NCBI-ProteinID: NP_001295919
Ensembl: ENSSHAG00000002065
UniProt: A0A076G1J6
LinkDB
Position
6
AA seq 140 aa
MNKVLLLSCLALTVLFASGAPTLPPPTTLLQYLIPDLIEVQKKLNDVSERMKRYELYIPS
NASSVADLQCFTKELNPVAEALKYESREAPDIQDHISNINLTVNNLMGSEIQCHYAAKIK
IAGFFQEFITFCQRLIQLTR
NT seq 423 nt   +upstreamnt  +downstreamnt
atgaacaaggtcctactcttgtcctgtcttgcactaactgttctctttgccagtggggca
ccaacattgcctcctcccaccactttgctgcagtacttaatacctgacttaatagaagtc
caaaagaaactcaatgatgtatcagaaaggatgaagagatatgaactctacatcccaagt
aatgccagtagcgtcgcagacctgcagtgtttcactaaagaactgaaccctgtggctgaa
gcattgaaatatgaatcaagagaagctccagatattcaggatcatatcagtaacattaat
ttgactgttaataacctaatgggatctgaaatacagtgtcactatgctgccaagattaag
atcgcaggattttttcaagaattcattactttctgccaaagactcatccaattaactcga
tga

DBGET integrated database retrieval system