KEGG   Sarcophilus harrisii (Tasmanian devil): 100935157Help
Entry
100935157         CDS       T02286                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00052  Galactose metabolism
shr00500  Starch and sucrose metabolism
shr01100  Metabolic pathways
shr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100935157 (MGAM)
   00500 Starch and sucrose metabolism
    100935157 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100935157 (MGAM)
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100935157 (MGAM)
    3.2.1.20  alpha-glucosidase
     100935157 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100935157
NCBI-ProteinID: XP_023361299
LinkDB All DBs
Position
5
AA seq 2043 aa AA seqDB search
MAKKTFSRLEIILSVLLLGLFIISIALIVLLATNTSGVKETITTSSPETTGTTTASPTVT
STSTSSTTLTPECPTVNLSERINCIPDQTPTQATCHQRGCCWSPQGPVTVPWCYFSKKYG
YQIKGSSNTSAGFTAQLSRLSTASMFGNDIANVILEAEYQTSNRFHFKIRDPNDVRYEVP
HEHVQPFTGNAANNLNYHVNIEKESFSIKVIRKSNNRVLFDTGIGPLLFAQQYLQLSIKL
PSANVYGLGEHVHQEYRHDMAWKTWPIFSRDNTPNDGMTNLYGAQTFFLCLEDISGLSFG
VFLMNSNAMEVALQPAPAITYRITGGILDFYVFLGNTPEEVVREYLELIGRPLLPSYWSL
GFHLSRWVYGGLDGMKKVVERNRAAQLPCDVQYSDIDYMDEKKDFTYDKVLFGGLPEFAE
DLHNHGQKYVIIMDPAIASDSPNYGPYVRGSNMKIWVNASDGVTPLIGKVWPGQTVFPDY
TNPKCAQWWAEEFSLFYKELKFDGIWIDMNEPSNFDDGSSTGCSHSNLNYPPFTPRILDH
FLPAKTLCMDAVQYWGKHYDVHNLYGYSMAIATEEAVKAVFNNKRSFIVTRSTFAGSGKF
AAHWLGDNAATWNDLRWSIPGVLEFNLFGIPMVGPDICGYANDVSEELCRRWMQLGAFYP
FSRNHNGQGYKDQDPAAFGEDSLLLNTSRHYLNIRYTLLPYLYTLFFQAHTRGDTVARPL
LHEFYADNYTWDVYRQFLWGPGLLITPVLEEGAEKVTAYMPDAIWYDYETGNRTSWRKQE
VELLLPPDKIGLHLRGGYIFPTQQPAITTVASRKNPLGLIIALDDNNEAKGELFWDDGET
KGTITSGAYILHEFLYTQNRLDVKILHNSYNDIYNLTFNEIKILGTKEPINIIVKKNNVL
IASSPNVTYIEEYQVAIISGLELSLGEEYTVELSFSFRDVDKIDCYPEDQAVSEENCTAR
GCVWELPSSPGVPSCYIINFLYSVSNIQSNPMGITADIFLNSALYASNLPSTPVNPLRLD
VTYHKNDMLQFKIYDANSKRYEVPVPLNIPRSPSSTPDNRLYEVFIKSNPFGIEIRRRST
GTVIWDSKIPGFTFNDMFLRISTRLPSHYIYGFGETEHTTFRRNLTWHTWGMFSRDQPPG
YKKNSYGVHPYYMALEEDGNAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPT
PDLVTQQYTKLVGRPVMTPYWALGFQLCRYGYQNDTEIAELYDAMVAAQIPYDVQYADID
YMERQLDFTLSSKFSGFPNLINRIKAAGMRVILILDPAISGNETIYPAFSRGLQDNVFIK
WPDDSDIVWGKVWPDLPNITINASLDWDTQVELYRAHVAFPDFFRNSTTIWWKRELQELH
TNPQEPQKSLKFDGMWIDMNEPSSFVNGAVPPGCRNTTLNHPPYMPYLESRDRGLSSKTL
CMESQQILPDGSPVRHYDVHNLYGWSQTKPTYEGVQEATGQRGIVVTRSTFPSSGRWAGH
WLGDNTAAWDQLHKSIIGMMEFSLFGISYTGADICGFFGDAEYEMCARWMQLGAFYPFSR
NHNTIGTRRQDPVAWNSTFEALSRKVLQTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFL
EDKETWDIYHQFLWGPAFLVSPVLTPNSRNLTAYFPKASWYDYYTGSGVGVRGQWTILHA
PLDHINLHIRGGYILPWQKPANNTHYSRKNSLGLIVALSDNGIAEGEFFWDDGQSIDTYE
KGDVYFSTFSASQNHLDVKIIDKNYSDPNGLAFEEIKIFGLDLKPLIVTVKENNVPVQTN
AEIQYDPATKVANITGLHLELGKEYTIEWSTQFTNTEKFDCYPDEQGVNEENCRLRDCVW
EEVSSPGVPFCYITKYYYTASNIQSSPAGLTATISRIPGASHYPSAPIDQLRLEVTFHTN
NMLQFKIDDANNKRYKVPVPLNIPSSPISQSENRLYEVTIKEKPFGIEIRRKSTGTVIWD
SQVPGFTFNDMFLRISTRLPSQYIYGFGETEHRKFRRDLNWHTWGMFSRDQPPGVRVSNW
NII
NT seq 6132 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaagacttttagcagattggagataatccttagtgttctgttactgggattg
ttcatcatctctattgccctgattgtgcttttagctacaaatacttcaggagtgaaagaa
actatcactacttcaagtcctgagacaacagggacgacaacagcctccccaacagtgact
tccacatccacctcttcgactactttaactccagaatgccctacagtaaacctgtcagaa
aggatcaactgcatccctgatcaaacaccaacacaggccacatgtcaccaacgtggttgt
tgctggagccctcagggaccagtaactgttccctggtgctacttctccaagaagtatggc
tatcagataaagggtagtagtaacacgagtgcaggattcacagcccagttaagccgactc
tccacagcttcgatgtttggaaatgatattgccaatgtcattcttgaagcagaataccag
acttccaatcgtttccatttcaagatccgagatcccaatgatgtcagatacgaagtccct
catgaacatgtccagccatttactggaaatgcagctaataatttgaactatcatgtgaac
attgaaaaggagtcatttagcatcaaagttatccggaaaagtaacaatcgtgttttattc
gacactggtattgggcctctcctatttgctcaacaatacctgcagctctccatcaagcta
cccagtgctaatgtgtatggcctaggggagcatgttcatcaagagtaccgtcatgatatg
gcttggaagacttggcccatcttctctcgggacaatactcctaatgatggcatgactaat
ttgtatggagcgcagacatttttcttgtgccttgaagatataagtggattatcctttgga
gtttttctgatgaacagcaatgccatggaggttgcccttcaacctgccccagcaatcact
tatcgaatcaccgggggtattctggacttttatgtcttcttagggaatactccagaagag
gttgttcgggaataccttgagcttattggaaggccactcttgccatcttattggtctctt
ggatttcatctcagtcgctgggtgtatggaggtttggatggaatgaagaaagttgtggag
agaaaccgagctgctcagcttccttgtgatgttcagtactctgatattgactatatggat
gagaagaaggatttcacttatgataaagtactatttggaggtctacctgaatttgctgag
gatttacataaccacggacagaaatatgtcattattatggatccagccattgccagtgac
tctcccaactatggtccttatgtccggggctcaaacatgaagatatgggtcaatgcatcg
gatggagtgacaccacttattgggaaggtgtggccgggccagacggtctttccagactat
accaatccaaagtgtgcccagtggtgggcagaggagttcagccttttctacaaggagcta
aagtttgatggaatctggattgatatgaatgaaccctccaactttgatgatggttcatct
acgggatgctcacatagtaacctgaactatcccccatttactcctagaatactggatcac
tttctacctgccaaaaccctttgcatggatgcagttcagtactggggaaaacactatgat
gttcacaatctgtatggttactccatggcaattgcaacagaagaggctgtaaaagctgtc
ttcaataataaaagaagctttattgtcacacgctctacctttgctgggtcaggcaaattt
gcagctcattggctgggggacaatgcagccacttggaatgaccttcgctggtctatacct
ggtgtgcttgagttcaacttgtttggtatccctatggtgggccctgacatctgtggttat
gccaatgatgtctcagaagaactatgcaggcggtggatgcagcttggtgcattttatcca
ttttccaggaatcacaatggtcaaggctacaaggatcaggaccctgctgcatttggagaa
gattctcttcttttaaatacctccagacactacctgaatatccgctatactctgctgcct
tatctctataccctctttttccaagctcacactcgaggggacactgtagcccgacccctt
ctacatgagttttatgctgacaattatacctgggatgtgtatcggcagtttttgtggggg
cctgggcttcttattactcctgttctggaggaaggggctgagaaagtgacagcatatatg
cctgatgctatctggtatgactatgaaactggtaatcggacatcatggagaaaacaagag
gttgagctgttactccccccagacaaaattggactccatcttcgaggaggctatattttc
cccacacagcagccagccatcaccacagtagcaagccgaaagaatcctcttggtctcatc
attgcccttgatgacaataatgaagctaaaggagaacttttttgggacgatggagaaact
aaaggtactataactagtggtgcctacatcttgcatgagtttttgtacacccaaaaccgt
ttagatgtgaagattttgcataattcatacaatgatatttataacttaacatttaacgag
attaaaatccttgggacaaaagaacctattaatatcattgtgaagaagaataatgtcctc
attgcatcttctcctaatgttacttatattgaagaataccaggttgctattatctcaggg
cttgaactttccttgggagaagaatacactgtggaattgagtttcagtttcagagatgtg
gacaaaatagactgttatcccgaggaccaagcagtctctgaagaaaactgcacagctcgt
ggctgtgtctgggagttacccagttctccaggagttcctagctgctatatcatcaatttc
ctatattcagtcagtaacattcaatccaacccaatggggattactgctgatatcttctta
aattcagctttgtatgcttccaatttgccttctactcctgtgaatcctctccgcttagat
gtcacctaccataagaatgatatgctgcagtttaagatctatgatgctaatagcaaaaga
tatgaggtcccagtgccactcaacatccctagatctccctctagtacccctgacaatcgg
ctctatgaagttttcataaagagcaatccttttggaattgagatccgacgccggagcact
ggcacagtaatttgggattctaagatccctggttttacctttaatgacatgttcctgcgc
atctctactcgcctcccatcccattacatctatggttttggggaaacggagcacacgacc
ttccgaagaaatctgacctggcacacatggggcatgttttctcgagaccagccccctggg
tacaagaagaattcctatggtgtgcacccttattatatggctctggaggaggatggcaat
gcacatggggtgctcctgctcaacagcaatgccatggatgtgactttccagcccaccccg
gcactgacataccgcaccactgggggcattctggacttctacatggttttgggaccaacc
ccagatcttgtcactcagcagtacaccaagttggttgggcgaccagtgatgacaccttat
tgggccttagggttccagctttgtcgctatggctaccagaatgatactgaaattgctgaa
ctttatgatgctatggtggcagcccagatcccttatgatgtgcagtatgcagatattgat
tacatggaacggcaactggacttcactctcagctccaagttttctggctttcccaatctg
atcaatagaataaaagcagccgggatgcgagtcatccttattctggacccagccatttct
ggtaatgagacaatttatcctgcattctctcgtggacttcaggataatgtgttcatcaaa
tggccagatgacagtgacattgtttggggaaaggtctggccagatttgcccaatattact
atcaacgcatctcttgattgggacacccaagtggagctatacagagctcatgttgccttc
ccagactttttccgtaattcaacaaccatatggtggaagcgtgaattacaagaactccac
accaatcctcaggagccacagaagagtctgaagtttgatggaatgtggattgacatgaat
gaaccatccagctttgtgaatggagcagttcctccaggctgcaggaataccacgctcaat
catcctccttatatgccctatctagagtcaagagacagaggcctgagcagcaagactctg
tgcatggaaagtcagcagatcctgcctgatggaagcccagtgagacactatgatgtgcac
aatctctatggctggtcccagactaagccaacatatgaaggtgtgcaggaggctactgga
cagagaggaattgtggtcactcgctccaccttcccttcttcaggacgctgggcaggacat
tggctgggggacaacactgcagcatgggaccagctccataaatccatcattggtatgatg
gaattcagcctctttggaatatcctatactggagccgatatctgtggcttctttggagat
gctgaatatgagatgtgtgctcgctggatgcaactgggagccttttaccctttctctagg
aaccacaataccattgggaccagaagacaagaccctgtggcttggaattccacctttgag
gctctttcaagaaaagtccttcagacaagatacaccctattgccttatctctataccctg
atgcacaaggcccatgtagaaggcagcactgtcgtccggccccttcttcatgaatttctg
gaagacaaagaaacgtgggacatataccatcaattcttgtgggggccagccttcctagtc
agtcctgtactgacacctaattcccggaatctcactgcctacttccctaaagccagctgg
tatgattattacacgggctcaggtgttggagtgaggggacagtggacgatcctgcatgct
cccttggaccacatcaatctccatatccgtggaggctacattcttccatggcaaaaacct
gccaataatactcactatagccggaaaaattccttgggacttattgtggctttatctgac
aacgggatagctgaaggagagtttttctgggatgatggacagagtattgatacttatgaa
aagggggatgtctatttctcaactttctctgccagtcagaatcatctagatgtgaagatt
atagacaagaactacagtgatccaaatggcctagcatttgaagagatcaaaatctttggg
ctggacctcaaaccacttattgttactgtgaaagaaaataatgttccagtacaaactaat
gctgagatccagtatgatcctgcaacaaaggttgctaacatcacagggcttcaccttgaa
ctgggaaaagaatacacaatagaatggtcaactcagttcacaaatacagaaaaatttgac
tgctaccctgatgaacaaggtgtcaatgaagaaaactgtcgattacgtgactgtgtctgg
gaggaagtcagttcccctggtgtccctttttgctatatcacaaaatattattatactgcc
tctaatattcagagtagtccagcaggcctgacagcaactatctcccgaattcctggagcc
agtcactatccttctgctcccatagatcaacttcgcttggaggtgactttccatacaaac
aacatgctgcagttcaagattgatgatgccaacaacaaaaggtacaaagtcccagtgccc
ttaaatattccaagctcccccatcagccaatcagaaaatcgtctctatgaagtaaccatc
aaggagaaaccatttggaattgagatccgccgaaaaagtacaggcactgtgatttgggat
tcccaggtccctggctttacctttaatgacatgttcctacgaatatctacccgactccca
tcccagtacatctatggctttggggaaactgagcacaggaaattccggagggacctcaac
tggcacacgtggggaatgttttctcgagaccagcccccaggggtaagggtcagcaactgg
aatatcatatga

DBGET integrated database retrieval system