KEGG   Sarcophilus harrisii (Tasmanian devil): 100935165
Entry
100935165         CDS       T02286                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00480  Glutathione metabolism
shr00980  Metabolism of xenobiotics by cytochrome P450
shr00982  Drug metabolism - cytochrome P450
shr00983  Drug metabolism - other enzymes
shr01100  Metabolic pathways
shr01524  Platinum drug resistance
shr05200  Pathways in cancer
shr05204  Chemical carcinogenesis
shr05225  Hepatocellular carcinoma
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100935165 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100935165 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    100935165 (GSTO1)
   00983 Drug metabolism - other enzymes
    100935165 (GSTO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100935165 (GSTO1)
   05204 Chemical carcinogenesis
    100935165 (GSTO1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100935165 (GSTO1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100935165 (GSTO1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100935165 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:shr02000]
    100935165 (GSTO1)
Enzymes [BR:shr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100935165 (GSTO1)
Transporters [BR:shr02000]
 Other transporters
  Pores ion channels [TC:1]
   100935165 (GSTO1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin
Other DBs
NCBI-GeneID: 100935165
NCBI-ProteinID: XP_003755447
Ensembl: ENSSHAG00000016340
LinkDB
Position
2
AA seq 242 aa
MSGEAVQSLGKGSVQPGPVPLGVIRLYSMRFCPFAQRTRLILKAKGIKHEVININLKNKP
EWYFKKHPLGLVPVLETSKGQLIHESSITCEYLDEVYPGKKLFPEDPYEKALQKMILESF
SKIPSLTKDALIAVRNGEDCTNQKAELRKEFSKLEEILCRQKTTFLGGNSVSMIDYLIWP
WFERLESYEIADCVEHTPALKLWIDAMKKDPTVESLLTDLKTYKGFFELYFQNNPDAFDY
GL
NT seq 729 nt   +upstreamnt  +downstreamnt
atgtcgggagaggcagtccagagcctgggaaaaggcagcgtccagcctggccccgtcccg
ctgggagtcatccggttgtacagcatgagattctgccccttcgcgcagagaacccggctc
atcctgaaggccaaaggcatcaagcatgaggtcatcaatattaatttgaaaaataagcct
gaatggtactttaagaaacacccccttggtctagtaccagttctggagactagtaagggt
cagctgatacatgagtcttccatcacttgtgaatatctagatgaagtttatccaggaaag
aagctgtttccagaagatccatatgagaaagctttacaaaagatgattttggagtcattt
tctaagataccatctttgactaaggatgctcttatagcagtacgaaatggggaagactgt
accaatcagaaagcagaactccgtaaggaattcagcaaactggaggagatcctttgccgg
cagaagacaactttcctgggtggaaactctgtgtctatgattgattacctcatctggcca
tggtttgaacggttggaatcatatgagatagctgactgtgtggaacacactcctgcttta
aagctgtggatcgatgccatgaagaaggaccccacagttgaatctcttctcactgatttg
aagacatataaaggcttctttgagctctactttcagaataatcctgatgcctttgactat
gggctgtga

DBGET integrated database retrieval system