KEGG   Sarcophilus harrisii (Tasmanian devil): 100935165Help
Entry
100935165         CDS       T02286                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00480  Glutathione metabolism
shr00980  Metabolism of xenobiotics by cytochrome P450
shr00982  Drug metabolism - cytochrome P450
shr00983  Drug metabolism - other enzymes
shr01524  Platinum drug resistance
shr05200  Pathways in cancer
shr05204  Chemical carcinogenesis
shr05225  Hepatocellular carcinoma
shr05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100935165
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100935165
   00982 Drug metabolism - cytochrome P450
    100935165
   00983 Drug metabolism - other enzymes
    100935165
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    100935165
   05204 Chemical carcinogenesis
    100935165
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    100935165
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100935165
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    100935165
Enzymes [BR:shr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100935165
Transporters [BR:shr02000]
 Other Transporters
  Pores ion channels [TC:1]
   100935165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 100935165
NCBI-ProteinID: XP_003755447
Ensembl: ENSSHAG00000016340
LinkDB All DBs
Position
1
AA seq 242 aa AA seqDB search
MSGEAVQSLVKGSVQPGPVPLGVIRLYSMRFCPFAQRTRLILKAKGIKHEVININLKNKP
EWYFKKHPLGLVPVLETSKGQLIHESSITCEYLDEVYPGKKLFPEDPYEKALQKMILESF
SKIPSLTKDALIAVRNGEDCTNQKAELRKEFSKLEEILCRQKTTFLGGNSVSMIDYLIWP
WFERLESYEIADCVEHTPALKLWIDAMKKDPTVESLLTDLKTYKGFFELYFQNNPDAFDY
GL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggagaggcagtccagagcctggtaaaaggcagcgtccagcctggccccgtcccg
ctgggagtcatccggttgtacagcatgagattctgccccttcgcgcagagaacccggctc
atcctgaaggccaaaggcatcaagcatgaggtcatcaatattaatttgaaaaataagcct
gaatggtactttaagaaacacccccttggtctagtaccagttctggagactagtaagggt
cagctgatacatgagtcttccatcacttgtgaatatctagatgaagtttatccaggaaag
aagctgtttccagaagatccatatgagaaagctttacaaaagatgattttggagtcattt
tctaagataccatctttgactaaggatgctcttatagcagtacgaaatggggaagactgt
accaatcagaaagcagaactccgtaaggaattcagcaaactggaggagatcctttgccgg
cagaagacaactttcctgggtggaaactctgtgtctatgattgattacctcatctggcca
tggtttgaacggttggaatcatatgagatagctgactgtgtggaacacactcctgcttta
aagctgtggatcgatgccatgaagaaggaccccacagttgaatctcttctcactgatttg
aagacatataaaggcttctttgagctctactttcagaataatcctgatgcctttgactat
gggctgtga

DBGET integrated database retrieval system