KEGG   Sarcophilus harrisii (Tasmanian devil): 105749995
Entry
105749995         CDS       T02286                                 

Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04060  Cytokine-cytokine receptor interaction
shr04151  PI3K-Akt signaling pathway
shr04210  Apoptosis
shr04630  JAK-STAT signaling pathway
shr04640  Hematopoietic cell lineage
shr05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:shr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    105749995
   04151 PI3K-Akt signaling pathway
    105749995
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105749995
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105749995
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    105749995
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105749995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:shr04050]
    105749995
   04090 CD molecules [BR:shr04090]
    105749995
Cytokine receptors [BR:shr04050]
 Interleukin receptor families
  IL3 receptor family
   105749995
CD molecules [BR:shr04090]
 Proteins
  105749995
SSDB
Motif
Pfam: IL6Ra-bind IL3Ra_N PLRV_ORF5 Tissue_fac DUF1934
Other DBs
NCBI-GeneID: 105749995
NCBI-ProteinID: XP_012401579
Ensembl: ENSSHAG00000002236
UniProt: G3VH71
LinkDB
Position
3
AA seq 355 aa
MADVIILLSFSMLPILAYSQIQKGEDLPIKNITIDMKTMLLRWTNVENVNNVTCSVKILS
KLVYQMKATNNHRCKIKNFHSWCQGVDFVIEGFSGKRFSETFHLPQRGEEGTTKENVSCE
IHDANFMGCKWTVRNTPGDIHYQFFYSQSPLTFVNRECPNYKTDSEGRRVGCHFDNLSEF
PNPYPYHFLVTGTSNGREVQCTDDNISLWDIEIFKPPNVTINCTSLRCRLQWQIPKTIQF
QDNAFEYQLQIQKIGDKNFSEVVFNIKRTTNYDYTISYGKYTVKIRTRKLFYKNWSEWSE
PQEFGEEVRKDNSLPVIMSLLGIAFIMLLIMGYLCKRYYVLQKIIPTVLYIRRPS
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggcagatgtcataattttgctttcattctcaatgttgccaatcctagcatacagccaa
atacagaaaggggaggatttgccaattaaaaacataactatagatatgaagacaatgtta
ttgagatggaccaatgtggagaatgtgaataacgtcacctgttctgttaaaatcctctca
aaattagtatatcagatgaaggcaacaaacaaccataggtgcaaaataaaaaatttccat
agctggtgccaaggggtagactttgtaattgaaggattttctgggaaaagattttcagaa
acattccatcttccccaaagaggagaagaagggaccactaaagaaaatgtgtcctgtgag
attcatgatgcaaatttcatgggctgcaaatggacagtgaggaatactccaggagatatc
cattatcaatttttttactcacaatccccactgacttttgtgaatagagaatgtccaaat
tacaagacagattctgaaggcagacgtgttggatgtcattttgataacctctcagaattc
ccaaacccttacccatatcatttcctagtgactggaaccagcaatggaagggaagtccag
tgtactgatgacaacatttcactatgggatattgaaatatttaaaccaccaaatgtcacc
ataaattgtacaagtcttagatgtagactgcagtggcagatacccaaaacaatacaattt
caggacaatgcctttgaatatcagcttcaaattcaaaagattggtgacaagaatttctct
gaagtggtctttaatattaaaagaacaacaaactatgactacacaattagttatggaaaa
tatactgtgaaaataagaacaagaaagttgttttataaaaattggagtgaatggagtgag
ccccaagaatttggtgaagaagtccgtaaagataattctctgcctgtaatcatgtcactt
ctgggaatagccttcattatgctgctcattatgggatatctctgtaaaaggtattatgtg
cttcaaaaaataattcctactgtcctctatattaggagaccaagttag

DBGET integrated database retrieval system