KEGG   Sarcophilus harrisii (Tasmanian devil): 105750789Help
Entry
105750789         CDS       T02286                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr00052  Galactose metabolism
shr00500  Starch and sucrose metabolism
shr01100  Metabolic pathways
shr04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:shr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105750789
   00500 Starch and sucrose metabolism
    105750789
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    105750789
Enzymes [BR:shr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     105750789
    3.2.1.20  alpha-glucosidase
     105750789
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil DUF5110 Gal_mutarotas_2 ISP3_C
Motif
Other DBs
NCBI-GeneID: 105750789
NCBI-ProteinID: XP_023361229
LinkDB All DBs
Position
5
AA seq 1154 aa AA seqDB search
MAKKISELAICLIFLLLIVLGINIALLVLLIQDVPFTPECPDTNLSERINCIPDKLATEA
LCHRRQCCWNPSGNSRAPSCFFPRNGGYKVTVTNTDKNLTELRRLPSPSLFGNDIIDVLL
TKEYQTPNRFHFKITDPKRNRFEVPHEHVQSSNQDSFSNFNYKVEVTENPFSIKIRRTEN
NKVLFDTSIGPLQYAEQYLQLSVRLPSHNVYGFGEHVHQQYLHNMNWKTWPIFTRDAIPN
ANMTNLYGAQTFFLCLEDNSGFSFGVFLMNSNAMEVALQPAPAVTYRVIGGILDFYVFLG
NNPEQVVQEYLKLIGLPFLPPYWSLGFQLSRRDYGGIEGLKSVVNRTRAVKIPYDVQYSD
IDYMDKKKVFTYDKDNFKGLDNFTKELHEKGQKYVIILIPGISKTLSYGPYENGSKMNIW
VAGTTGPVVGEVWQEPTVFPDYTNPQGIEWWIDELELFHKKLNFDGVWIDMNEVSNFLND
KLQCENNYLNKPEFIPGILDRQLFAQTLCMDAEHYWGLHYDVHSLYGYSMTIATANAMKK
IFSNKRSFILTRSTFAGSGKFAAHWLGDNEATWKDLQWSIPSILEFNLFGIPMVGANICG
FASNATEELCRRWMQLGAFYPFSRNHNGAGFTDQDPAAFGINSMLLDSSRYYLNIRYRLL
PYLYTLFYKAHNQGNTVARPLVHEFYQDAETWSIHQQFLWGPGLLITPVLHSGVDRVKAY
IPDAIWYNYETNVAIPERKKWMEMLLPGDKIGLHLRGGYIFPTQEPAETTEASRKNPLGF
IIALDDKKEAKGELFWDDGETMEYKEKEQFFFAKFNVIQDVLKIIISHNFYLNETNTLKV
GKIEIWGINYDIITQVNITYSNGTSVETNFSSDPSKQILTIHLTNKMISLEELSQVTWRG
NSHVTTTSSDIPTTTTDFSLTTSTRSHTIFTTSLATSIAGVFTTSAPDIFPTSISSTTHY
PTEITSNTMDISTMSAPPITTAAFSTNTAIIPSTFPTSISFPTDAITHNITDTILSTTTS
GTSAAPPSSNPVTMSNTSISTDIAGDITSSTPSSFQTNVSSTTDAITHYTTDTILSTTTS
GTSAALPPNPVTMSNSSISTASTNGISTNSTTAPSTFPMNISSTTDAITHFTTDTILSTT
TNGTSAAPPPILFQ
NT seq 3465 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaaatttctgaattggcaatctgtttgatcttcctcctcctaattgttttg
ggcattaacattgctttgctggttcttctgatacaagatgtcccctttactccagaatgt
ccggatactaacctgtcagaaaggataaattgtattccagacaagttggcaacagaggca
ctctgccaccgccgccagtgttgctggaacccttcaggaaacagcagggccccctcctgc
ttcttccccaggaatgggggctataaagtcacagtcacaaacacagacaaaaacttgaca
gaattgagaagattgccatccccatctctatttggaaatgacatcattgatgttctcctc
acaaaagaataccagacacctaatcgctttcactttaagatcactgatcctaaaaggaat
cggtttgaagtcccccatgaacatgttcaatcatcaaatcaagattcattctccaatttt
aactataaggtagaagtcacagaaaatcccttcagcatcaaaataagaaggaccgagaac
aacaaagtcctcttcgacacaagcattgggcccctccagtatgctgagcagtacctgcag
ctctctgtccgactgcccagtcacaatgtgtatggatttggggagcatgtgcaccagcag
taccttcataatatgaactggaagacttggcccatcttcactagggatgccattcctaat
gctaacatgactaacttgtatggtgctcagacattcttcttatgtcttgaagacaacagt
ggtttttcatttggagttttcctaatgaacagtaatgccatggaggttgcccttcagcct
gcccctgcagttacttaccgtgtaattggtgggattcttgacttctacgtgttcttggga
aataatccagagcaagttgttcaggaatacttgaagctcattggattacccttcttgccc
ccttactggagtcttggcttccagctaagtcgtagggattatggaggcattgaaggactg
aaatctgttgtcaacagaacacgtgctgttaagataccttatgatgtccagtactctgac
atagactacatggataagaagaaggtctttacttatgataaagataatttcaaaggcctt
gacaactttactaaagaattgcatgaaaaggggcagaaatatgtcattattctgattcct
ggcatctccaaaaccctttcgtatggtccctatgagaatggaagcaaaatgaacatctgg
gttgctggaactactgggcccgtcgttggggaggtatggcaagaacctactgttttccct
gattacaccaacccacaaggcattgagtggtggattgatgagttggaattgtttcataaa
aaactgaattttgatggcgtctggattgatatgaatgaagtgtccaactttttaaatgat
aaattacaatgtgaaaataattacttgaataagccagaatttattcccggaatcttggat
agacaactgtttgcacagactctctgcatggatgcagagcattactggggtctgcactat
gatgttcacagtttatatggctactctatgacaattgcaacagcaaatgccatgaagaaa
attttttctaataaaagaagtttcatcttgactcgatcaacctttgctgggtcaggcaaa
tttgcagctcactggctaggggataatgaagccacttggaaggatctccaatggtccatt
cccagcattcttgagttcaacctttttggtatccccatggtgggcgcaaacatctgtggc
ttcgcctccaacgccacggaggagctgtgcaggcgctggatgcagctgggagccttctat
ccgttttccagaaatcacaacggcgccggtttcacggaccaagatcctgctgcttttgga
ataaactccatgcttttggattcttccagatactacttgaatatccgctacagacttttg
ccttacctgtacacccttttctataaagctcataaccaaggaaacactgtggcccggcct
cttgtccatgagttctaccaggacgcagagacatggagcatacatcagcaattcctttgg
ggtcctggcttgctcatcacaccagttctacattcaggtgtggaccgagtgaaggcatac
atccctgatgccatctggtataactatgagacaaatgtagctattccagagagaaagaaa
tggatggagatgcttcttcctggggacaagataggactacaccttcgagggggctacatc
ttccccacacaggagccagctgagaccacagaagccagtcgtaaaaatcctttgggattc
atcattgccctggatgacaaaaaagaagcaaagggagagctgttttgggatgatggtgaa
acaatggaatataaggagaaagaacaatttttttttgcaaagtttaatgtgattcaggat
gtcttgaaaatcatcattagtcacaacttttacttgaatgaaacaaatactctaaaagtt
ggaaagattgaaatttggggaataaattatgacattataactcaggtcaacattacctat
tccaatgggacttctgtggaaactaactttagcagtgacccatcaaaacagatactaacc
attcacttgactaacaagatgatcagcctggaagaactatctcaagttacttggaggggt
aatagtcatgtgactactacttcaagtgacatcccaacaactactactgatttttctctg
actacttctaccagaagtcatactatatttactacttcacttgctactagtattgctggt
gtatttactactagtgcaccagatattttcccgacaagtatttcatctaccactcattac
ccaacagaaataacttcaaacaccatggatattagtactatgtctgctcctcctattact
actgctgcttttagtactaatactgctataattccaagcactttcccaacaagtatttca
ttccccactgatgcaattactcataatattacagatacaattctaagtaccactactagt
ggtactagtgctgctcccccttcttctaatccagttaccatgagcaatactagtattagt
actgatattgctggtgatattactagtagtactccaagttcctttcaaacaaatgtttca
tccaccactgatgcaattactcattacactacagacacaattctaagtaccactactagt
ggaactagtgctgctctccctcctaatccagtcaccatgagcaatagtagtattagtact
gctagtactaatggtattagcactaatagtactactgctccaagtacttttccaatgaat
atttcatccaccactgatgcaattactcatttcactacagacacaattctaagcaccact
accaatggtactagtgctgctccccctcctatacttttccaatga

DBGET integrated database retrieval system