KEGG   Stereum hirsutum: STEHIDRAFT_102745Help
Entry
STEHIDRAFT_102745 CDS       T03127                                 

Definition
(RefSeq) glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
shs  Stereum hirsutum
Pathway
shs00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:shs00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    STEHIDRAFT_102745
Enzymes [BR:shs01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     STEHIDRAFT_102745
Transporters [BR:shs02000]
 Other Transporters
  Pores ion channels [TC:1]
   STEHIDRAFT_102745
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N
Motif
Other DBs
NCBI-GeneID: 18794547
NCBI-ProteinID: XP_007308402
JGI: Stehi1_102745
LinkDB All DBs
Position
Unknown
AA seq 269 aa AA seqDB search
MSTEPEGRPAKMQKTEAYKLYYWPSIPGRGEFIRLVFEYAGSSYTEHNDPASLMPTIGDA
TKTGGIPHFAVPALELPNGKFLSQTPAILNYLAPKLGLDGSKGLKGEEKEDVEERELVRS
WVNQLVLTALDLNNEVHDVHHPIASSLYYEEQKDAALERAKDFRALRLPKYFAHFQNVLE
SNKAGKGKYLVSESTTTADITLFHIITGLLYAFPKRTEKLRASDDYPLVFALHERVSNEK
GIKEYLASERRLPFGMGVFRHYEELDGEE
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgaacccgaaggccgtccagccaagatgcagaaaaccgaagcctataagctc
tactactggccctctatccctggacgcggtgaattcatccgtctcgtcttcgaatatgcc
ggctcctcctacaccgaacacaatgaccccgcctccctcatgcccaccatcggcgatgcc
accaaaaccggcggaatcccacatttcgcggttcccgcgctcgagcttccgaacgggaag
tttctcagccagacgccggcaatcttgaattacttggcgccgaagttggggctggatggt
tcgaaggggttgaagggcgaggagaaggaggatgtggaagagagggagttggttaggtcg
tgggtgaatcagttggtgttgacggcgctggatctgaataatgaggtacacgatgtccac
cacccaatcgccagctccctttactatgaagagcaaaaagatgcggctctcgaacgtgct
aaagatttccgcgcgcttcgtctaccgaagtatttcgcgcatttccagaacgtcctcgag
agtaacaaagctggcaaaggaaaatacctcgtttcggagagcaccactactgcggacatc
accctcttccacattatcaccggtctactctatgcgttccctaaaaggacggagaagctc
cgagcttcggacgactaccccctcgtcttcgccctccacgaacgtgtctcgaacgagaag
ggaataaaggagtatctcgccagcgagcggaggcttccgtttgggatgggggtgttcagg
cattatgaggagttggatggggaggaatga

DBGET integrated database retrieval system