KEGG   Stereum hirsutum: STEHIDRAFT_114908Help
Entry
STEHIDRAFT_114908 CDS       T03127                                 

Definition
(RefSeq) Arginase/deacetylase
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
shs  Stereum hirsutum
Brite
KEGG Orthology (KO) [BR:shs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:shs03036]
    STEHIDRAFT_114908
Enzymes [BR:shs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     STEHIDRAFT_114908
Chromosome and associated proteins [BR:shs03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     STEHIDRAFT_114908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 18795715
NCBI-ProteinID: XP_007309301
JGI: Stehi1_114908
LinkDB All DBs
Position
Unknown
AA seq 688 aa AA seqDB search
METPSTSGPISQPRIGGPATAVFLQDACLQHRYIRSRDTSNIVELPERLRAVKLGIAAAV
ARLEDEHNMVSSSPSSVEKPNVLTTSGSTASTVSAVSTNLSTDSADDLAAALGDLNIASS
SISSPSTVSEELLLSSNSDTPPPLRIFRSSAKVDILNNAAVKYVHGDIEGDVYLEKLRDL
ARDSAEKIKQGQSEIPDEWSQGDLYLCPQSLDAMQGALGTVCEAVDTVIRDDNPTKRAFV
TIRPPGHHCGEDTPSGFCFVNNVAVGAAHAHLKHNIKRILIFDIDLHHGNGTQSIAWQIN
EETYRSKIETEAAGLGAPPPPPPGAQIFYGSVHDILSYPCEDGKPHLVQAASVSIHGPHG
QYIENVHLEPYESETQFFDVLYKGAYSRLLTKAREFVETTGEGSDDVLVFISCGFDASEH
EYPSMSRHARKVPTSFFHRFTLDACAFASQYAKGRLISVLEGGYSGRALLSGGMAHIVGL
VDSEKEGESVEEKTRSRERWWSKDNVLMLDKLTKKPSRRAPRSSTGKAASSSALNNSPWY
NRTAALLELFDPASNYPSSSANKAPLVPPSTRTLRTRSPNPMGSKLKSPGQSPKGIKSAG
GPRGKRKDVKEVRVVSMSESTGSSFSTSEDSEVDVDGGVVPEVKIESVVEVKGEGDKELA
TSIPTSVSAEKKLPRVVLKLGTRPDPEL
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atggagacaccgtccacttccgggcctatctcccaaccgcgaatcggagggccagccact
gcagtcttcctccaagatgcatgcttgcagcaccgttatattcgctctagggatacttct
aatattgtcgagctcccagaacggcttcgagccgtcaagttgggtatcgcagctgctgtc
gcgcggcttgaggatgagcacaacatggtttcgagctcaccatcgtcggtggagaagcca
aacgtgttgactaccagcggttccactgcgtccacagtttctgctgtcagtacgaacttg
tccacggactctgctgacgatctcgccgcggccctgggagatctcaacattgcttcatcc
tcgatctcaagcccatccacagtctctgaggaacttctcctttcctcgaactctgacaca
cctccaccactccgcatttttcgatcctcggccaaggttgatatcctcaataacgcagct
gtcaagtacgttcatggtgatatagaaggtgacgtctatctcgagaaacttcgagatctg
gccagagacagtgcagaaaagatcaagcaaggacagagtgagattccggacgagtggtct
caaggcgatttgtacctgtgcccgcaatctctggacgcaatgcaaggtgcccttgggaca
gtttgcgaagctgtcgatactgtaatacgtgacgacaatcctacgaagagagcctttgtt
acgattcgacctcctgggcatcattgcggggaagacacgccttccgggttttgtttcgtg
aacaatgtagctgtcggggctgctcatgcccacctcaaacataacatcaagcgcatcctc
attttcgatatcgacctgcaccatgggaacggcacccaatcgattgcctggcagatcaac
gaagaaacctatcgctctaagatcgaaaccgaagcagcaggactgggcgctccgccacca
ccacctcccggcgcccagatcttctatggatccgtccacgacatactttcctatccctgc
gaggacggcaaaccacatctcgtgcaagcagcctccgtttccattcacggtcctcacgga
caatacattgaaaatgtccacctcgagccttacgagtctgagacgcagttctttgacgtg
ttgtataaaggcgcttatagccggctattgacaaaagccagagagttcgtcgaaactacg
ggggaagggagtgacgatgttctcgtgttcatcagttgcggcttcgacgcctctgaacac
gaatatccctcaatgtcccgccacgctcgtaaagtccccacttccttcttccaccgattc
accctcgatgcctgtgcattcgcctctcaatacgccaaaggcagactcatcagcgtgctt
gagggagggtacagcggcagggcgttgttgagtggcgggatggcccatatcgtagggtta
gttgattctgagaaagagggtgagtcggtggaggagaagacgagatcgagagagagatgg
tggagtaaggataatgtgttaatgctcgacaaactcaccaagaagccctcccgacgtgct
cctcgctcttccaccggcaaagcagcctcttcttctgccctgaacaatagtccttggtac
aaccgtacagctgccctcctcgaactcttcgatcccgcgtccaactacccgtctagtagt
gcgaacaaagcaccgttagtcccgccaagtaccaggacactaaggactaggtcgccaaat
ccgatgggttcgaagttgaagtcgccgggacaatctccaaaagggatcaagagcgctggt
ggtccgagaggtaaaagaaaggatgtcaaggaggtgcgggtagtgagtatgagtgagagt
acggggtcgagcttcagtaccagtgaggattccgaggttgatgtcgatgggggtgtggtg
ccggaggtgaaaatcgagagtgtcgtagaggttaaaggtgagggtgacaaggagctggct
acgtcaatccctaccagtgtcagcgcagagaagaaattgcccagggtggtattgaagttg
gggacacgtcctgatcctgaactctga

DBGET integrated database retrieval system