KEGG   Stereum hirsutum: STEHIDRAFT_119931Help
Entry
STEHIDRAFT_119931 CDS       T03127                                 

Definition
(RefSeq) SWIRM-domain-containing protein
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
shs  Stereum hirsutum
Brite
KEGG Orthology (KO) [BR:shs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:shs03021]
    STEHIDRAFT_119931
   03036 Chromosome and associated proteins [BR:shs03036]
    STEHIDRAFT_119931
Transcription machinery [BR:shs03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     STEHIDRAFT_119931
Chromosome and associated proteins [BR:shs03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    STEHIDRAFT_119931
   PBAF complex
    STEHIDRAFT_119931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM SWIRM-assoc_1 Myb_DNA-binding ZZ Myb_DNA-bind_6 Zip
Motif
Other DBs
NCBI-GeneID: 18796579
NCBI-ProteinID: XP_007302099
JGI: Stehi1_119931
LinkDB All DBs
Position
Unknown
AA seq 747 aa AA seqDB search
MDSPKRTASPSPDASESKRIRLTVPQQNQGASPVDPENAQGKRSELDPIQGGELGNIPNY
PPSSPGPETGGKVTLLKPEGEGVDDDNADVEMGDGQDDDGESGDDNDDEDPAQLEANRQR
LEEQARKYLAAQTHQVIIPSYSAWFDMSAIHAVERRALPEFFNGKNRSKTPAIYKDYRDF
MVNTYRLRPTEYLTVTACRRNLAGDVCAIMRVHAFLEQWGLINYQIDPDQRPAALAPPFT
GHFRVILDTPRGLQSLHPGSRPSQHPGGQGPNGSTTKRSSGPTPASLELRSSIYQTTSKS
ARQVSESEAAILANGTTSAGSNARPTNAVTYKCDTCGVDCTAVRYHSLKVKDFELCQPCY
LDGRFPSTMFSGDFVRLTNSASVSGNQHSAANGGDAWSDQELLLLLEGVEMYDDDWSLIE
EHVGTRSAQQCVRKFLELPIEDPYLESEGDMGAMRYARVPFEQADNPVMSVVAFLAGVVG
PGVAAEAAKTALGELTKGEEKESKVPESDKEEKEKEKEGEKAATVEGEEGGHKDNEDDKM
DEDKVEGELSTPQQPEKAEASSSKPTTPAATGAESSDAQATSSPAAEKPGPGVPHSKVVR
AANLALKASAKAASSLVSAEETNIRSTLAAVIKLQLTKLELKMSQFEELEDLLEEERRAL
EGARLALVSERMTLKKNLENVRGELSKHAQNQGAGGAGNMQGIVAAASQANMGTSSQGTR
MQDISLDGMAMEGDGGPLNGGNVVALS
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggactctcccaaacggaccgcgtctccctctccagacgcatccgagtcgaagcgtatt
aggctaaccgtgccacaacaaaatcaaggtgcatctcctgtggaccctgaaaacgctcaa
ggcaagcgtagcgagctcgaccccatccagggcggcgaactcggtaacattcccaactac
cccccgtcttcaccaggaccagaaactggaggcaaggtcaccttgctcaagccagaaggc
gagggcgtggacgacgacaatgccgacgtcgagatgggagatggtcaggatgacgatggc
gagtcgggagacgataatgacgacgaagatcccgcccaactcgaggcgaataggcagaga
ctggaggaacaggcgcgcaaatacctggctgcacagacgcatcaagtcatcattccctct
tattccgcctggttcgacatgtctgctatccatgcggtcgagcgacgcgccttacccgag
ttcttcaacggcaagaacaggtctaagacgcctgccatctacaaggactatcgcgacttt
atggtcaatacctaccgtcttcgccccacagaatacctcacagttactgcttgtcggagg
aatcttgctggagacgtgtgcgctattatgcgtgtacatgccttcttggagcaatgggga
ttaataaactaccagatcgacccagaccagcgccccgccgccctcgcccctcctttcacc
ggtcacttccgcgtcattctcgacaccccccgcggccttcaatcccttcaccccggctcc
cgcccctctcaacacccaggcggccaaggccccaacggctcaaccaccaaacgatcttcc
ggccccacccccgcctccctcgaactccgctctagcatctaccaaaccacgtccaaatcc
gcccgccaagtctccgaatccgaggctgctatcctcgccaacggcaccacatctgctggc
tcgaatgcccgtcccacgaacgccgttacctataagtgtgacacgtgtggcgtggattgt
acggcggtgcggtaccattccctcaaagttaaggatttcgagctctgtcagccttgttat
ctcgacgggaggttcccttcgaccatgttcagcggcgacttcgtgcgcctgacgaactcg
gcgtccgtcagcgggaaccagcactctgcagcgaacggaggggacgcatggtccgaccag
gaattgctgctcttgctcgagggcgtggagatgtacgacgacgactggtcgttgatcgag
gagcacgtcgggacgcggtcggcgcagcagtgcgtgcgcaagtttttggagctgccgatc
gaggatccgtacctcgagagcgagggagatatgggggcgatgaggtacgcgagagtgccg
tttgagcaggcggataatccggtcatgagtgtcgtcgcgtttttggcgggggtggttgga
cccggggtcgcggctgaggcggcgaagacagcgttaggagagctgacgaagggagaagag
aaggagagcaaggtgccggagtcggacaaggaggagaaagaaaaggagaaagagggagag
aaggctgctacggtggagggcgaagaagggggacacaaggataacgaagacgacaagatg
gatgaggataaggtggagggagaactatctacgcctcaacagcctgaaaaggcggaggcc
tcatcgagcaagccgacgactcctgctgcaacgggcgcggaatcgagcgacgctcaggcg
acttcgtcacctgcagcagaaaaacctggccctggcgttccgcattccaaggtggtccgc
gccgccaatcttgccctgaaggcgtccgcgaaagccgcatcttcactggtatctgccgaa
gaaaccaacatccgttcaactctcgcggccgtgatcaagctccaacttacgaaactcgag
ctcaagatgtcacaattcgaagaactggaggatttattggaggaggaacgaagagcactc
gagggcgcgagactggctttggtcagcgagaggatgacgctgaagaagaacctggagaac
gtgagaggagagttatcaaagcacgcgcagaatcagggagcgggcggggctgggaatatg
caagggattgtcgccgcggcgtcgcaggcaaatatgggaacgtcgagtcagggtaccaga
atgcaggatatttccctggacgggatggcgatggagggggatgggggtccgttgaatggt
gggaatgtggtggcgctttcttaa

DBGET integrated database retrieval system