KEGG   Stereum hirsutum: STEHIDRAFT_121051Help
Entry
STEHIDRAFT_121051 CDS       T03127                                 

Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
shs  Stereum hirsutum
Pathway
shs00020  Citrate cycle (TCA cycle)
shs00480  Glutathione metabolism
shs01100  Metabolic pathways
shs01110  Biosynthesis of secondary metabolites
shs01130  Biosynthesis of antibiotics
shs01200  Carbon metabolism
shs01210  2-Oxocarboxylic acid metabolism
shs01230  Biosynthesis of amino acids
shs04146  Peroxisome
Module
shs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
shs_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:shs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    STEHIDRAFT_121051
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    STEHIDRAFT_121051
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    STEHIDRAFT_121051
Enzymes [BR:shs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     STEHIDRAFT_121051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 18796781
NCBI-ProteinID: XP_007303673
JGI: Stehi1_121051
LinkDB All DBs
Position
Unknown
AA seq 418 aa AA seqDB search
MYDKIAVKNPVVELDGDEMTRIIWKKIREELVLPYLDLDIKYYDLGVESRDATNDQVTVD
SANAILEYGVGIKCATITPDEARVQEFNLKQMWRSPNGTIRNILGGTVFREPIILDRIPR
PVPGWTNPIVIGRHAFGDQYRSTDFVAPGPGKIQLVYTPEGGGKPTVMDIYDFKGKGVAM
AMYNTDDSISGFAHSSFKMALAKKMPLFMSTKNTILKKYDGRFKDIFQEIYESQYKPEFE
KAGIYYEHRLIDDMVAQAIKSSGGFVWACKNYDGDVQSDILAQGFGSLGMMTSELITPDG
KVIESEAAHGTVTRHYREYQKGNETSTNPVASIFAWTRGLIHRAKLDSNTLLKEWAEELE
KSCVEVIDEDGVMTKDLALAIHGKGMKREHWVVTDVYMDAVKSKLDKKLAAKAKKSTS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtatgacaaaattgcggtgaagaacccggtggtcgagctcgatggagacgagatgacc
cgtatcatctggaagaagattcgtgaagagctcgtcctgccgtacttggacctggacatc
aagtactacgaccttggcgtggagagccgtgatgctaccaacgaccaagtcaccgtagac
tccgccaatgccattctcgaatacggtgttggtatcaagtgcgcgaccatcactcctgac
gaggctcgcgtccaggaattcaacctcaaacaaatgtggcgctcgcccaacggaaccatc
cgtaacatcctcggcggcaccgtcttccgtgaacccatcatcctcgaccgtatcccccgc
cccgtcccaggttggacaaaccccatcgtcatcggccgtcacgccttcggcgaccaatac
cgctcgacagacttcgtagcaccaggacccgggaagattcagttggtgtatacgccagag
ggaggaggaaagccgactgtcatggatatatatgatttcaagggcaagggtgtggcgatg
gcgatgtataacactgatgactcgatatcaggatttgcccactcttcgttcaagatggcg
ttggccaagaagatgccgctcttcatgtcgacgaagaacaccatcctcaagaagtacgac
ggccgcttcaaggacatcttccaggagatctacgaatcccaatacaagcccgaattcgaa
aaagccgggatctactacgaacatcgtctgatcgatgacatggtcgcgcaggccatcaag
tcctccggaggattcgtctgggcgtgcaagaactacgacggagacgtgcagtctgatatc
ctcgcacagggcttcggaagtttgggaatgatgacgagcgagttgatcacgcccgacggg
aaggtgatcgagagtgaggcggcgcacggaactgtcacccggcactaccgcgaataccaa
aaaggcaacgaaacgtccacgaaccccgtcgcgtccatcttcgcatggacccgtgggctc
atccaccgcgcgaaactcgattcgaacaccctgttgaaggagtgggcggaagagctggag
aagtcgtgtgtggaggtgattgatgaggacggggtgatgacgaaggatttggcgttggcg
atccatgggaaggggatgaagagggagcattgggtcgttacggatgtttatatggatgct
gtcaagagcaagctcgacaagaagctcgcggccaaggcgaagaagtccacctcgtga

DBGET integrated database retrieval system