KEGG   Stereum hirsutum: STEHIDRAFT_123978Help
Entry
STEHIDRAFT_123978 CDS       T03127                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
shs  Stereum hirsutum
Pathway
shs00500  Starch and sucrose metabolism
shs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:shs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    STEHIDRAFT_123978
Enzymes [BR:shs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     STEHIDRAFT_123978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 18797336
NCBI-ProteinID: XP_007307664
JGI: Stehi1_123978
LinkDB All DBs
Position
Unknown
AA seq 588 aa AA seqDB search
MRSFTSLLQVASLCVGLVSSVWAQSSTAEAYIASESPIAKANLLANIGPSGSKSQGAKAG
VVIASPSNTNPNYLFTWTRDSSLVFKAIIDQFVLGLDSSLESQIQNFVTAEQILQQVSNP
SGSVSTGGLGEPKFNIDESAFTGAWGRPQRDGPALRATALITWSNWLRNNGGSSTVTGTI
WPMIVLDLNYVANNWNQTTFDLWEEVSSSSFFTTSVQHRALREGIILATALGQTSNVASW
TTQANNLLCFLQSFWNPTSGYITANTGGGRSGKDANTILASIHTFDPAALCDVTTFQPCS
DKALANLKVYTDAFRTIYGINSAVAAGQPVATGRYPEDSYMGGNPWYLATLAVAEQLYDS
LIVWNKAGNLNITSTSLPFFQGLANVGTIATGTFSSNSTTFQSVTAAVQLLADGYVDVVA
KFTPSGGGLAEQYDRNTGVPVSAVDLTWSYASVLTATMARSGVVGESWGAAGLTTSCSTT
GGGGGGGGGGSSGTVAVTFNVQATTVFGENIFLTGSVDQLENWSPTNAIPLSAANYPTWS
VTVNLPASTSIQYKYIRINNGQVTWESDPNMQITTPSSGTFTENDTWR
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgttcacctcactcctccaagtcgcctcactctgtgttggtctcgtttcgtcc
gtatgggctcagtccagcacggccgaggcatacatcgcgtcggagtctcccattgctaag
gcaaacctgctcgccaacatcggacccagtggttctaaatcacagggtgcgaaggctggt
gtggttatcgcctcgccgtccaacacgaacccgaactacttgttcacttggacccgcgac
agctctctggttttcaaggccatcatcgatcaatttgtccttggccttgattcgtctttg
gagtcacagattcagaatttcgtcactgctgaacaaattcttcaacaagtatctaaccct
tctgggtcggtctccaccggcggccttggggagcctaagttcaacatcgacgagtccgcg
tttactggtgcctggggtaggccgcagcgtgacggtcctgcgttgcgcgccaccgcgctt
atcacatggtccaattggttgcgcaacaatggtggttccagtacagtcactggcaccata
tggccaatgatcgtgctcgatttaaactatgtcgcgaacaactggaatcagaccacgttc
gatttgtgggaagaagtttcgtcgtcgtctttcttcacgacctccgtccagcaccgtgcg
ctccgtgagggtatcatccttgctactgccctcggtcagacttccaacgtcgccagctgg
acgacccaggccaacaatcttctgtgcttcctccagtcgttctggaaccccaccagcggc
tatatcacagccaataccggcggaggccgttctggcaaggatgccaacacaatcctcgcc
tccatccataccttcgaccccgccgctttgtgcgatgtgacgaccttccaaccatgcagc
gacaaggctctagccaacttgaaggtctatacggatgccttcaggactatctacggtatc
aactctgccgttgccgctggccagcccgttgccactggtcggtaccccgaagactcgtac
atgggcggtaacccgtggtacctcgcgacactggccgttgcagagcagctctacgactcc
ctcatcgtgtggaacaaggccggcaacctgaacatcaccagcacctcgctccccttcttc
caaggcctcgccaacgtcggaaccatcgccaccggcaccttctcctccaacagcaccacc
ttccagtccgtcaccgccgccgtccagctcctcgccgacggctacgtcgacgtcgtcgca
aagttcactccctccggtggaggactcgcggaacagtacgatcgtaacaccggtgtgccc
gtcagcgcggttgacctgacgtggtcttatgcgtctgtcttgactgctacgatggcgcgt
agtggggtggtgggagagagctggggagctgcgggtttgacgacgagttgttcgactact
ggtggtgggggtggtggaggtggtggaggaagcagtggtacggtcgctgtaaccttcaac
gtgcaggctaccacggtgtttggagagaacatcttcttgactgggtccgtcgaccagctt
gagaattggtctcccaccaacgctatccccttgagcgcggcgaactacccaacttggagt
gtcaccgtcaacctccccgcgtcgacgtcgatccagtacaaatacatccgcatcaacaac
ggccaggtcacttgggagagcgacccgaatatgcagatcactacgccatccagcggcacc
ttcaccgagaacgacacttggcgttaa

DBGET integrated database retrieval system